PRGWK00001924 (Sotub08g006270.1.1)

From PRG Wiki
Revision as of 15:18, 15 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search


Sotub08g006270.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location 8
Location Start 1272252
Location End 1275310
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGCAACTCCAATCACAAAAACCCCATCACCTGCATGTACAAAATTCATAGAAGAAATCACAAGAATTTACAAATCACTCCCACCAAGACCATCCATTTTAGAAATTGAAGCTTCAATTTCTGTAATAAAATCAGTAGAAACAGAAGAAAAAATAGAACTTGATGAAATTTCCAAGAAAGTAGTGGAGATAGAAGAAAATGTTCCAGCTGAGCTTTTCTCTGTGTTACAACAAGTGAGAAAAGCT


Protein Sequences

MATPITKTPSPACTKFIEEITRIYKSLPPRPSILEIEASISVIKSVETEEKIELDEISKKVVEIEENVPAELFSVLQQVRKAMVLFQSKEQRKEAVQLIELDKTYQDFDVLIQEATELISGDTQMGKINSFEDPIGEIGKKDENLMKGLVTSCELITVSSSGIKHKEKYSLMKVAALIENAAKTRARVVDLHNKLMDKIEWLPLSLGKLVNVTELNVADNQIMALPTTIGSLNALTKLDLHSNQIIN


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox