PRGAV00000040 (MP)

From PRG Wiki
Jump to: navigation, search


MP
Gene Type Avirulence Genes
GenBank 266548 (P29800)
Gene Species Tomato mosaic virus

Comment?

Description

Movement protein (Cell-to-cell transport protein) (30 kDa protein)

Sequence

MALVVKGKVNINEFIDLSKSEKLLPSMFTPVKSVMVSKVDKIMVHKNESLSEVNLLKGVKLIEGGYVWLVGLVVSGEWNLPDNCRGGVSVCMVDKRMERADEATLGSYYTAAAKKRFQFKVVPNYGITTKDAKKNIWQVLVNIKNVKMSAGYCPLSLEFVSVCIVYKNNIKLGLREKVTSVKDGGPMELSEEVVDEFMENVPMSVRLAKFRTKPSKRGPKNNNNLGKGRSGGRPKPKSFDEVEKEFDNLIEDEAETSVADSDSY




List of Contributions

There has not been any contribution yet.




Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox