PRGDB00000029 (Asc-1)

From PRG Wiki
Jump to: navigation, search
Asc-1
Gene Type Reference_R-Genes,_manually_curated
GenBank 7688741 (AF198177)
Gene Class Other
Domain Type
Chromosome 3
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum ASC1 (Asc) gene, Asc-1 allele, complete cds.

DNA Sequence

ATGAAAAACCTGGATCACATCGCTGCTTCGGTTGATTGGGAGAAAGAGTCTCTCCCTGAGTACCAGGATTTGATATTTCTCTTATTTTTTGCTCTCTTCTTCCCCGTTCTTCGATTCATACTCGACAGATTTGTTTTCGAGGCATTGGCTAAGCGTATGATTTTTGGAAAGAAGACGGTTGTAAATATTAACGGTCGTGAAGAGAGGAAGAAGATCAACAAATTCAAAGAGTCAGCATGGAAATTTGTATATTTTCTATCTGCTGAGCTACTTGCACTTTCTGTGACTTGTAATGAGCCTTGGTTCACAGATAGTCGGTATTTCTGGGCAGGACCTGGAGATGTGGTTTGGCCTAATTTGAAAATGAAATTAAAGCTAAAATTATTGTACATGTATGCTGGAGGATTCTACTTTTACTCCATATTCGCAACACTTTATTGGGAAACAAGACGCTATGATTTTGCTGCGCAGATAATTCATCATGTAACAACAGTGTCACTCATTGTGTTGTCTTACGTATACGGGTTTGCGCGTATTGGATCAGTGGTTCTAGCACTTCATGACGGAAGTGATGTATTCATGGAAATTGCAAAGATGTCGAAATACAGTGGCTTTGATTTGATTGCTGATATTTTCTTCTCTCTTTTCGCGTTGGTTTTTACATCACTTCGTATAATCTGCTATCCCTTCTGGATAATCCGAAGCACATGCTACGAACTTCTTTATGTATTGGATATACAGAAGGAACGGACTACTGGGATCATACTTTACTTTGTTTTCAATGCATTGCTGATATGCTTGCTGGTTCTTCACCTCTTTTGGTTCAAAATCATACTGCGGATGGTCAAGAACCAAATCCTATCAAGAGGCCACATTACTGATGATGTTCGAGAAGATTCTGAATCTGATGATGACCACAAAGACTGA


Protein sequences

Name Description Sequence
ASC1 ASC1 [Lycopersicon esculentum].

MKNLDHIAASVDWEKESLPEYQDLIFLLFFALFFPVLRFILDRFVFEALAKRMIFGKKTVVNINGREERKKINKFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNLKMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIGSVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILRMVKNQILSRGHITDDVREDSESDDDHKD


Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF005225
IPR016439
1-306 LAG1_LAC1
Longevity assurance, LAG1/LAC1

MKNLDHIAASVDWEKESLPEYQDLIFLLFFALFFPVLRFILDRFVFEALAKRMIFGKKTVVNINGREERKKINKFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNLKMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIGSVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILRMVKNQILSRGHITDDVREDSESDDDH

HMMPanther: PTHR12560
21-308 PTHR12560,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

YQDLIFLLFFALFFPVLRFILDRFVFEALAKRMIFGKKTVVNINGREERKKINKFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNLKMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIGSVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILRMVKNQILSRGHITDDVREDSESDDDHKD

HMMSmart: SM00724
IPR006634
73-287 TLC
TRAM/LAG1/CLN8 homology domain

NKFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNLKMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIGSVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILRMVKNQIL

ProfileScan: PS50922
IPR006634
73-287 TLC
TRAM/LAG1/CLN8 homology domain

NKFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNLKMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIGSVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILRMVKNQIL

HMMPfam: PF03798
IPR006634
74-280 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

KFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNLKMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIGSVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYELLYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILR


Diseases

Disease Pathogen Avirulence gene
Alternaria Stem Canker Alternaria alternata

List of References

B F Brandwagt, L A Mesbah, F L Takken, P L Laurent, T J Kneppers, J Hille, H J Nijkamp
A longevity assurance gene homolog of tomato mediates resistance to Alternaria alternata f. sp. lycopersici toxins and fumonisin B1.
Proc. Natl. Acad. Sci. U.S.A.: 2000, 97(9);4961-6
PubMed:10781105 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox