PRGDB00000031 (Bs4)

From PRG Wiki
Jump to: navigation, search
Bs4
Gene Type Reference_R-Genes,_manually_curated
GenBank 38489218 (AY438027)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Chromosome 5
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum bacterial spot disease resistance protein 4 (Bs4) gene, Bs4-MM allele, complete cds.

DNA Sequence

ATGGCATCTTCTTCTTCTTCTTCTGCAAGTAATTCAAAGTATTATCCTCGATGGAAGTACGTTGTTTTTCTAAGTTTCAGAGGTGAAGACACTCGAAAAACATTTACAGGTCACTTATACGAAGGTTTGAGAAATAGAGGAATAAACACATTTCAAGATGATAAAAGACTAGAGCATGGAGATTCAATTCCAAAAGAACTCTTGAGAGCTATAGAAGATTCTCAAGTTGCACTTATCATTTTCTCAAAGAATTATGCTACATCTAGGTGGTGCTTGAATGAACTAGTGAAGATCATGGAATGCAAAGAGGAAGAAAATGGACAAACAGTCATACCGATCTTTTATAATGTGGATCCATCACATGTTCGATACCAAACTGAAAGCTTTGGAGCAGCATTTGCCAAACACGAATCAAAGTATAAGGATGATGTTGAGGGGATGCAGAAGGTGCAAAGATGGAGAACTGCCCTAACTGCTGCCGCAAATCTAAAAGGATATGATATCCGTAACGGGATTGAATCAGAGAATATTCAGCAGATCGTAGATTGCATCTCTTCCAAATTTTGTACGAATGCTTATTCTTTATCTTTTTTGCAAGATATTGTGGGAATAAATGCTCACTTAGAGAAACTAAAATCGAAACTTCAAATAGAAATCAATGATGTTCGGATTTTAGGGATCTGGGGAATAGGCGGAGTCGGTAAAACAAGAATAGCAAAAGCCATTTTTGATACTCTATCTTATCAATTTGAAGCTTCTTGTTTTCTTGCTGATGTTAAAGAATTTGCAAAAAAGAATAAACTGCATTCTTTACAAAATATTCTTCTCTCTGAACTGTTAAGGAAAAAAAATGATTACGTCTACAACAAGTATGATGGAAAGTGTATGATTCCAAACAGACTTTGTTCTTTGAAGGTTCTAATTGTGCTTGATGATATAGATCATGGTGATCAGATGGAGTATTTAGCAGGTGATATTTGTTGGTTTGGTAATGGCAGCAGAGTTATTGTAACAACTAGAAACAAACATTTGATAGAGAAAGATGATGCGATATACGAAGTGTCTACACTGCCTGATCATGAAGCTATGCAATTATTCAATATGCATGCTTTTAAAAAAGAAGTTCCAAATGAGGATTTTAAGGAGTTGGCGTTAGAGATAGTAAATCACGCTAAAGGCCTCCCTTTAGCCCTCAAGGTGTGGGGCTGTTTATTGCATAAAAAAAATCTCTCTTTATGGAAAATAACAGTAGAGCAAATAAAGAAAGACTCTAATTCAGAAATTGTTGAACAACTCAAAATAAGTTATGATGGGTTGGAGTCCGAAGAGCAGGAAATATTTTTAGATATAGCATGTTTCTTCCGCGGAGAGAAAAGAAAAGAGGTCATGCAAATTCTTAAGAGTTGTGACTTTGGAGCTGAATACGGATTGGATGTTCTGATTAATAAATCTCTTGTGTTCATATCTGAAAATGACAGGATTGAAATGCATGATTTGATTAGAGATATGGGTAGATATGTGGTGAAAATGCAAAAGCTTCAGAAAAAACGTAGCAGAATATGGGATGTTGAAGATTTCAAAGAAGTGATGATAGACTATACGGGGACCATGACAGTGGAAGCAATCTGGTTTAGTTGCTTTGAAGAAGTACGTTTTAATAAGGAGGCAATGAAAAAAATGAAAAGGCTTAGGATATTACACATATTTGATGGTTTTGTCAAATTCTTCTCTTCGCCTCCCTCTTCCAATTCCAATGATTCAGAAGAAGAAGATGATTCCTACGACTTAGTCGTAGATCACCATGATGACTCTATTGAGTACCTGTCCAATAACTTGCGTTGGTTAGTCTGGAATCACTATTCTTGGAAGTCATTGCCAGAAAATTTTAAACCAGAAAAGCTTGTTCATCTTGAACTCCGTTGGAGTTCGCTTCATTATTTATGGAAGAAAACAGAGCATTTGCCGTCTCTACGAAAGCTAGATCTCAGCTTATCTAAAAGTCTGGTGCAAACACCAGATTTCACGGGGATGCCAAATTTGGAGTATTTGAATCTGGAGTACTGTAGTAAGCTTGAAGAGGTTCACTATTCCCTAGCATATTGCGAAAAACTCATTGAGTTAAATTTGAGTTGGTGTACAAAGCTTAGGAGATTTCCATATATTAACATGGAATCTCTTGAATCTCTGGATCTACAATATTGCTATGGTATAATGGTGTTTCCAGAAATCATCGGAACGATGAAGCCGGAGTTAATGATTCTCTCAGCAAACACTATGATAACTGAACTACCATCATCTCTTCAGTACCCAACTCATCTCACAGAGCTAGATTTGAGTGGCATGGAAAACCTTGAAGCTCTTCCAAGCAGCATTGTCAAGTTGAAAGATTTGGTGAAGCTAAATGTGTCGTACTGCTTAACGCTTAAAAGCTTGCCTGAAGAGATTGGTGATTTAGAAAACTTGGAGGAACTTGATGCTTCGCGTACTCTAATTTCACAGCCTCCATCTTCCATTGTCCGCTTGAACAAGCTTAAATCCTTGAAGTTAATGAAACGAAACACATTAACAGATGATGTGTGCTTTGTGTTTCCTCCTGTGAATAACGGGTTACTCTCATTGGAAATTCTGGAGCTCGGTTCCTCCAATTTCGAAGATGGAAGAATTCCGGAAGATATTGGATGTTTATCCTCTTTGAAAGAGTTACGTCTCGAGGGAGATAATTTCAATCATTTGCCTCAAAGCATAGCCCAACTTGGTGCACTTCGATTCTTATACATAAAAGATTGCAGGAGTCTTACAAGTCTGCCAGAATTTCCACCGCAATTAGATACAATATTTGCAGATTGGAGCAATGATTTGATCTGTAAGTCACTGTTTCTAAATATCTCATCATTCCAACATAACATCTCTGCTTCAGATTCGTTGTCGTTAAGAGTGTTTACGAGTTTGGGGAGTAGTATCCCAATCTGGTTCCACCATCAGGGAACAGATACAAGTGTTTCAGTCAATTTGCCTGAAAACTGGTATGTATCAGATAACTTCTTGGGATTCGCTGTATGTTACTATGGCAATTTAACTGAGAACACAGCTGAATTGATTATGAGTTCTGCAGGGATGCCATGTATCACCTGGAAACTTTTGTTATCGAATCATTCAGAATGTACATATATTAGGATTCATTTTTTCTTGGTACCTTTTGCTGGCTTATGGGATACATCTAACGCCAATGGTAAAACACCAAATGACTATAAGCACATTATGTTATCTTTTCCTCAAGAATTGAAGGAGTGTGGAGTTCGTTTGTTCTATGAAGATGAATCTGTGCTTGAGACCACCAATGATGAACTTACCATTGGGGTAAGGAGGATCAGATACGACGACGACGATAGTGAACATTATGAGGAGGCTGGTTGTTCCTCTTCTAAGAAACAAAGATCATAA


Protein sequences

Name Description Sequence
bacterial spot disease resistance protein 4 bacterial spot disease resistance protein 4 [Lycopersicon esculentum].

MASSSSSSASNSKYYPRWKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRNGIESENIQQIVDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSLFLNISSFQHNISASDSLSLRVFTSLGSSIPIWFHHQGTDTSVSVNLPENWYVSDNFLGFAVCYYGNLTENTAELIMSSAGMPCITWKLLLSNHSECTYIRIHFFLVPFAGLWDTSNANGKTPNDYKHIMLSFPQELKECGVRLFYEDESVLETTNDELTIGVRRIRYDDDDSEHYEEAGCSSSKKQRS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
8-166 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SASNSKYYPRWKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGY

Gene3D: G3DSA:3.40.50.10140
17-156 G3DSA:3.40.50.10140

RWKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTA

ProfileScan: PS50104
IPR000157
18-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANL

HMMSmart: SM00255
IPR000157
19-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANL

HMMPfam: PF01582
IPR000157
22-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALT

HMMPanther: PTHR11017
50-958 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRNGIESENIQQIVDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSL

HMMPanther: PTHR11017:SF20
50-958 PTHR11017:SF20,SUBFAMILY NOT NAMED

TFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRNGIESENIQQIVDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSL

superfamily: SSF52540
181-428 SSF52540

VDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEI

Gene3D: G3DSA:3.40.50.300
199-347 G3DSA:3.40.50.300

QDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEK

HMMPfam: PF00931
IPR002182
205-469 NB-ARC,NBS
NB-ARC

NAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSC

FPrintScan: PR00364
IPR000767
224-239 DISEASERSIST
Disease resistance protein

ILGIWGIGGVGKTRIA

FPrintScan: PR00364
IPR000767
300-314 DISEASERSIST
Disease resistance protein

RLCSLKVLIVLDDID

FPrintScan: PR00364
IPR000767
391-405 DISEASERSIST
Disease resistance protein

AKGLPLALKVWGCLL

superfamily: SSF46785
426-531 SSF46785

SEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMI

superfamily: SSF52058
495-973 SSF52058,LRR

EMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSLFLNISSFQHNISASD

Gene3D: G3DSA:3.80.10.10
608-851 G3DSA:3.80.10.10

LSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMK

FPrintScan: PR00364
IPR000767
652-668 DISEASERSIST
Disease resistance protein

EHLPSLRKLDLSLSKSL

Gene3D: G3DSA:3.80.10.10
864-940 G3DSA:3.80.10.10

PPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPP


Diseases

Disease Pathogen Avirulence gene
Bacterial Spot Xanthomonas campestris PRGAV00000030
Bacterial Spot Xanthomonas campestris PRGAV00000031

List of References

Sebastian Schornack, Agim Ballvora, Doreen G├╝rlebeck, Jack Peart, David Baulcombe, Martin Ganal, Barbara Baker, Ulla Bonas, Thomas Lahaye
The tomato resistance protein Bs4 is a predicted non-nuclear TIR-NB-LRR protein that mediates defense responses to severely truncated derivatives of AvrBs4 and overexpressed AvrBs3.
Plant J.: 2004, 37(1);46-60
PubMed:14675431 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox