PRGDB00000031 (Bs4)

From PRG Wiki
Jump to: navigation, search
Bs4
Gene Type Reference_R-Genes,_manually_curated
GenBank 38489218 (AY438027)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Chromosome 5
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum bacterial spot disease resistance protein 4 (Bs4) gene, Bs4-MM allele, complete cds.

DNA Sequence

ATGGCATCTTCTTCTTCTTCTTCTGCAAGTAATTCAAAGTATTATCCTCGATGGAAGTACGTTGTTTTTCTAAGTTTCAGAGGTGAAGACACTCGAAAAACATTTACAGGTCACTTATACGAAGGTTTGAGAAATAGAGGAATAAACACATTTCAAGATGATAAAAGACTAGAGCATGGAGATTCAATTCCAAAAGAACTCTTGAGAGCTATAGAAGATTCTCAAGTTGCACTTATCATTTTCTCAAAGAATTATGCTACATCTAGGTGGTGCTTGAATGAACTAGTGAAGATCATGGAATGCAAAGAGGAAGAAAATGGACAAACAGTCATACCGATCTTTTATAATGTGGATCCATCACATGTTCGATACCAAACTGAAAGCTTTGGAGCAGCATTTGCCAAACACGAATCAAAGTATAAGGATGATGTTGAGGGGATGCAGAAGGTGCAAAGATGGAGAACTGCCCTAACTGCTGCCGCAAATCTAAAAGGATATGATATCCGTAACGGGATTGAATCAGAGAATATTCAGCAGATCGTAGATTGCATCTCTTCCAAATTTTGTACGAATGCTTATTCTTTATCTTTTTTGCAAGATATTGTGGGAATAAATGCTCACTTAGAGAAACTAAAATCGAAACTTCAAATAGAAATCAATGATGTTCGGATTTTAGGGATCTGGGGAATAGGCGGAGTCGGTAAAACAAGAATAGCAAAAGCCATTTTTGATACTCTATCTTATCAATTTGAAGCTTCTTGTTTTCTTGCTGATGTTAAAGAATTTGCAAAAAAGAATAAACTGCATTCTTTACAAAATATTCTTCTCTCTGAACTGTTAAGGAAAAAAAATGATTACGTCTACAACAAGTATGATGGAAAGTGTATGATTCCAAACAGACTTTGTTCTTTGAAGGTTCTAATTGTGCTTGATGATATAGATCATGGTGATCAGATGGAGTATTTAGCAGGTGATATTTGTTGGTTTGGTAATGGCAGCAGAGTTATTGTAACAACTAGAAACAAACATTTGATAGAGAAAGATGATGCGATATACGAAGTGTCTACACTGCCTGATCATGAAGCTATGCAATTATTCAATATGCATGCTTTTAAAAAAGAAGTTCCAAATGAGGATTTTAAGGAGTTGGCGTTAGAGATAGTAAATCACGCTAAAGGCCTCCCTTTAGCCCTCAAGGTGTGGGGCTGTTTATTGCATAAAAAAAATCTCTCTTTATGGAAAATAACAGTAGAGCAAATAAAGAAAGACTCTAATTCAGAAATTGTTGAACAACTCAAAATAAGTTATGATGGGTTGGAGTCCGAAGAGCAGGAAATATTTTTAGATATAGCATGTTTCTTCCGCGGAGAGAAAAGAAAAGAGGTCATGCAAATTCTTAAGAGTTGTGACTTTGGAGCTGAATACGGATTGGATGTTCTGATTAATAAATCTCTTGTGTTCATATCTGAAAATGACAGGATTGAAATGCATGATTTGATTAGAGATATGGGTAGATATGTGGTGAAAATGCAAAAGCTTCAGAAAAAACGTAGCAGAATATGGGATGTTGAAGATTTCAAAGAAGTGATGATAGACTATACGGGGACCATGACAGTGGAAGCAATCTGGTTTAGTTGCTTTGAAGAAGTACGTTTTAATAAGGAGGCAATGAAAAAAATGAAAAGGCTTAGGATATTACACATATTTGATGGTTTTGTCAAATTCTTCTCTTCGCCTCCCTCTTCCAATTCCAATGATTCAGAAGAAGAAGATGATTCCTACGACTTAGTCGTAGATCACCATGATGACTCTATTGAGTACCTGTCCAATAACTTGCGTTGGTTAGTCTGGAATCACTATTCTTGGAAGTCATTGCCAGAAAATTTTAAACCAGAAAAGCTTGTTCATCTTGAACTCCGTTGGAGTTCGCTTCATTATTTATGGAAGAAAACAGAGCATTTGCCGTCTCTACGAAAGCTAGATCTCAGCTTATCTAAAAGTCTGGTGCAAACACCAGATTTCACGGGGATGCCAAATTTGGAGTATTTGAATCTGGAGTACTGTAGTAAGCTTGAAGAGGTTCACTATTCCCTAGCATATTGCGAAAAACTCATTGAGTTAAATTTGAGTTGGTGTACAAAGCTTAGGAGATTTCCATATATTAACATGGAATCTCTTGAATCTCTGGATCTACAATATTGCTATGGTATAATGGTGTTTCCAGAAATCATCGGAACGATGAAGCCGGAGTTAATGATTCTCTCAGCAAACACTATGATAACTGAACTACCATCATCTCTTCAGTACCCAACTCATCTCACAGAGCTAGATTTGAGTGGCATGGAAAACCTTGAAGCTCTTCCAAGCAGCATTGTCAAGTTGAAAGATTTGGTGAAGCTAAATGTGTCGTACTGCTTAACGCTTAAAAGCTTGCCTGAAGAGATTGGTGATTTAGAAAACTTGGAGGAACTTGATGCTTCGCGTACTCTAATTTCACAGCCTCCATCTTCCATTGTCCGCTTGAACAAGCTTAAATCCTTGAAGTTAATGAAACGAAACACATTAACAGATGATGTGTGCTTTGTGTTTCCTCCTGTGAATAACGGGTTACTCTCATTGGAAATTCTGGAGCTCGGTTCCTCCAATTTCGAAGATGGAAGAATTCCGGAAGATATTGGATGTTTATCCTCTTTGAAAGAGTTACGTCTCGAGGGAGATAATTTCAATCATTTGCCTCAAAGCATAGCCCAACTTGGTGCACTTCGATTCTTATACATAAAAGATTGCAGGAGTCTTACAAGTCTGCCAGAATTTCCACCGCAATTAGATACAATATTTGCAGATTGGAGCAATGATTTGATCTGTAAGTCACTGTTTCTAAATATCTCATCATTCCAACATAACATCTCTGCTTCAGATTCGTTGTCGTTAAGAGTGTTTACGAGTTTGGGGAGTAGTATCCCAATCTGGTTCCACCATCAGGGAACAGATACAAGTGTTTCAGTCAATTTGCCTGAAAACTGGTATGTATCAGATAACTTCTTGGGATTCGCTGTATGTTACTATGGCAATTTAACTGAGAACACAGCTGAATTGATTATGAGTTCTGCAGGGATGCCATGTATCACCTGGAAACTTTTGTTATCGAATCATTCAGAATGTACATATATTAGGATTCATTTTTTCTTGGTACCTTTTGCTGGCTTATGGGATACATCTAACGCCAATGGTAAAACACCAAATGACTATAAGCACATTATGTTATCTTTTCCTCAAGAATTGAAGGAGTGTGGAGTTCGTTTGTTCTATGAAGATGAATCTGTGCTTGAGACCACCAATGATGAACTTACCATTGGGGTAAGGAGGATCAGATACGACGACGACGATAGTGAACATTATGAGGAGGCTGGTTGTTCCTCTTCTAAGAAACAAAGATCATAA


Protein sequences

Name Description Sequence
bacterial spot disease resistance protein 4 bacterial spot disease resistance protein 4 [Lycopersicon esculentum].

MASSSSSSASNSKYYPRWKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRNGIESENIQQIVDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSLFLNISSFQHNISASDSLSLRVFTSLGSSIPIWFHHQGTDTSVSVNLPENWYVSDNFLGFAVCYYGNLTENTAELIMSSAGMPCITWKLLLSNHSECTYIRIHFFLVPFAGLWDTSNANGKTPNDYKHIMLSFPQELKECGVRLFYEDESVLETTNDELTIGVRRIRYDDDDSEHYEEAGCSSSKKQRS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
8-166 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SASNSKYYPRWKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGY

Gene3D: G3DSA:3.40.50.10140
17-156 G3DSA:3.40.50.10140

RWKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTA

ProfileScan: PS50104
IPR000157
18-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANL

HMMSmart: SM00255
IPR000157
19-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANL

HMMPfam: PF01582
IPR000157
22-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALT

HMMPanther: PTHR11017
50-958 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRNGIESENIQQIVDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSL

HMMPanther: PTHR11017:SF20
50-958 PTHR11017:SF20,SUBFAMILY NOT NAMED

TFQDDKRLEHGDSIPKELLRAIEDSQVALIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAKHESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRNGIESENIQQIVDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSL

superfamily: SSF52540
181-428 SSF52540

VDCISSKFCTNAYSLSFLQDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEI

Gene3D: G3DSA:3.40.50.300
199-347 G3DSA:3.40.50.300

QDIVGINAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEK

HMMPfam: PF00931
IPR002182
205-469 NB-ARC,NBS
NB-ARC

NAHLEKLKSKLQIEINDVRILGIWGIGGVGKTRIAKAIFDTLSYQFEASCFLADVKEFAKKNKLHSLQNILLSELLRKKNDYVYNKYDGKCMIPNRLCSLKVLIVLDDIDHGDQMEYLAGDICWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMQLFNMHAFKKEVPNEDFKELALEIVNHAKGLPLALKVWGCLLHKKNLSLWKITVEQIKKDSNSEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSC

FPrintScan: PR00364
IPR000767
224-239 DISEASERSIST
Disease resistance protein

ILGIWGIGGVGKTRIA

FPrintScan: PR00364
IPR000767
300-314 DISEASERSIST
Disease resistance protein

RLCSLKVLIVLDDID

FPrintScan: PR00364
IPR000767
391-405 DISEASERSIST
Disease resistance protein

AKGLPLALKVWGCLL

superfamily: SSF46785
426-531 SSF46785

SEIVEQLKISYDGLESEEQEIFLDIACFFRGEKRKEVMQILKSCDFGAEYGLDVLINKSLVFISENDRIEMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMI

superfamily: SSF52058
495-973 SSF52058,LRR

EMHDLIRDMGRYVVKMQKLQKKRSRIWDVEDFKEVMIDYTGTMTVEAIWFSCFEEVRFNKEAMKKMKRLRILHIFDGFVKFFSSPPSSNSNDSEEEDDSYDLVVDHHDDSIEYLSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMKRNTLTDDVCFVFPPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPPQLDTIFADWSNDLICKSLFLNISSFQHNISASD

Gene3D: G3DSA:3.80.10.10
608-851 G3DSA:3.80.10.10

LSNNLRWLVWNHYSWKSLPENFKPEKLVHLELRWSSLHYLWKKTEHLPSLRKLDLSLSKSLVQTPDFTGMPNLEYLNLEYCSKLEEVHYSLAYCEKLIELNLSWCTKLRRFPYINMESLESLDLQYCYGIMVFPEIIGTMKPELMILSANTMITELPSSLQYPTHLTELDLSGMENLEALPSSIVKLKDLVKLNVSYCLTLKSLPEEIGDLENLEELDASRTLISQPPSSIVRLNKLKSLKLMK

FPrintScan: PR00364
IPR000767
652-668 DISEASERSIST
Disease resistance protein

EHLPSLRKLDLSLSKSL

Gene3D: G3DSA:3.80.10.10
864-940 G3DSA:3.80.10.10

PPVNNGLLSLEILELGSSNFEDGRIPEDIGCLSSLKELRLEGDNFNHLPQSIAQLGALRFLYIKDCRSLTSLPEFPP


Diseases

Disease Pathogen Avirulence gene
Bacterial Spot Xanthomonas campestris PRGAV00000030
Bacterial Spot Xanthomonas campestris PRGAV00000031

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox