PRGDB00000032 (Cf-2)

From PRG Wiki
Jump to: navigation, search
Cf-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 1184074 (U42444)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 6
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium leucine rich repeat protein Cf-2.1 gene, complete cds.

DNA Sequence

ATGATGATGGTTTCTAGAAAAGTAGTCTCTTCACTTCAGTTTTTCACTCTTTTCTACCTCTTTACAGTTGCATTTGCTTCGACTGAGGAGGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGAATAATTCCTTTTTGGCTTCATGGATTCCAAGTTCTAATGCATGCAAGGACTGGTATGGAGTTGTATGCTTTAATGGTAGGGTAAACACGTTGAATATTACAAATGCTAGTGTCATTGGTACACTCTATGCTTTTCCATTTTCATCCCTCCCTTCTCTTGAAAATCTTGATCTTAGCAAGAACAATATCTATGGTACCATTCCACCTGAGATTGGTAATCTCACAAATCTTGTCTATCTTGACTTGAACAACAATCAGATTTCAGGAACAATACCACCACAAATCGGTTTACTAGCCAAGCTTCAGATCATCCGCATATTTCACAATCAATTAAATGGATTTATTCCTAAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCCATTCCTGCTTCAGTGGGGAATCTGAACAACTTGTCTTTTTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAAGTTACCTAAGATCTCTTACTGAGCTAGATTTGAGTGATAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATATGAACAACTTGTCTTTTTTGTTTCTTTATGGAAATCAGCTTTCTGGCTCTATTCCTGAAGAAATATGTTACCTAAGATCTCTTACTTACCTAGATTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATTTGAACAACTTGTCTTTTTTGTTTCTTTATGGAAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGATCTCTTAATGTCCTAGGTTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAAAAACTTGTCTAGGTTGAATCTTGTTAATAATCAGCTTTCTGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTATGTTGTATCTTTACAATAACCAGCTTTCTGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTAGGTTGTATCTCTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACTTGAGTTCTCTTACTTATCTAGATTTGAGTAATAACTCCATTAATGGATTTATTCCTGCTTCATTTGGCAATATGAGCAACTTGGCTTTTTTGTTTCTTTATGAAAATCAGCTTGCTAGCTCTGTTCCTGAAGAAATAGGTTACCTAAGGTCTCTTAATGTCCTTGATTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTCGGGAATTTGAACAACTTGTCTAGGTTGAATCTTGTTAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTAATGTCCTTGATTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTCGGGAATTTGAACAACTTGTCTAGGTTGAATCTTGTTAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGATCTCTTAATGACCTAGGTTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACTTGAGTTCTCTTACTTATCTATCTTTGGGTAATAACTCTCTTAATGGACTTATTCCTGCTTCATTTGGCAATATGAGAAATCTGCAAGCTCTGATTCTCAATGATAACAATCTCATTGGGGAAATTCCTTCATCTGTGTGCAATTTGACATCACTGGAAGTGTTGTATATGCCGAGAAACAATTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTAACCTTCAGGTTTTGTCGATGTCATCTAATAGTTTCAGTGGAGAGCTCCCTTCATCTATTTCCAATTTAACATCACTACAAATACTTGATTTTGGCAGAAACAATCTGGAGGGAGCAATACCACAATGTTTTGGCAATATTAGTAGCCTCGAGGTTTTTGATATGCAGAACAACAAACTTTCTGGGACTCTTCCAACAAATTTTAGCATTGGATGTTCACTGATAAGTCTCAACTTGCATGGCAATGAACTAGAGGATGAAATCCCTCGGTCTTTGGACAATTGCAAAAAGCTGCAAGTTCTTGATTTAGGAGACAATCAACTCAACGACACATTTCCCATGTGGTTGGGAACTTTGCCAGAGCTGAGAGTTTTAAGGTTGACATCGAATAAATTGCATGGACCTATAAGATCATCAAGGGCTGAAATCATGTTTCCTGATCTTCGAATCATAGATCTCTCTCGCAATGCATTCTCGCAAGACTTACCAACGAGTCTATTTGAACATTTGAAAGGGATGAGGACAGTTGATAAAACAATGGAGGAACCAAGTTATGAAAGCTATTACGATGACTCGGTGGTAGTTGTGACAAAGGGATTGGAGCTTGAAATTGTGAGAATTTTGTCTTTGTACACAGTTATCGATCTTTCAAGCAACAAATTTGAAGGACATATTCCTTCTGTCCTGGGAGATCTCATTGCGATCCGTATACTTAATGTATCTCATAATGCATTGCAAGGCTATATACCATCATCACTTGGAAGTTTATCTATACTGGAATCACTAGACCTTTCGTTTAACCAACTTTCAGGAGAGATACCACAACAACTTGCTTCTCTTACGTTTCTTGAATTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGACCTCAATTCCGTACCTTTGAGAGCAATTCATATGAAGGTAATGATGGATTACGTGGATATCCAGTTTCAAAAGGTTGTGGCAAAGATCCTGTGTCAGAGAAAAACTATACAGTGTCTGCGCTAGAAGATCAAGAAAGCAATTCTGAATTTTTCAATGATTTTTGGAAAGCAGCTCTGATGGGCTATGGAAGTGGACTGTGTATTGGCATATCCATGATATATATCTTGATCTCGACTGGAAATCTAAGATGGCTTGCAAGAATCATTGAAAAACTGGAACACAAAATTATCATGCAAAGGAGAAAGAAGCAGCGAGGTCAAAGAAATTACAGAAGAAGAAATAATCACTTCTAG


Protein sequences

Name Description Sequence
Cf-2.1 Cf-2.1 [Lycopersicon pimpinellifolium].

MMMVSRKVVSSLQFFTLFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGCGKDPVSEKNYTVSALEDQESNSEFFNDFWKAALMGYGSGLCIGISMIYILISTGNLRWLARIIEKLEHKIIMQRRKKQRGQRNYRRRNNHF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1014 PTHR24420,FAMILY NOT NAMED

MMMVSRKVVSSLQFFTLFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG

superfamily: SSF52058
26-373 SSF52058,LRR

ASTEEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSG

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVC

Gene3D: G3DSA:3.80.10.10
87-247 G3DSA:3.80.10.10

YAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLY

HMMPfam: PF12799
95-132 LRR_4,Leucine Rich repeats (2 copies)

PSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQIS

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLENLDLSKNNIYGTIPPEIGNL

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNNNQISGTIPPQIGLL

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASVGNL

HMMPfam: PF00560
IPR001611
192-212 LRR_1
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIS

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEISYL

HMMPfam: PF13855
216-275 LRR_8,Leucine rich repeat

SLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENAL

ProfileScan: PS51450
IPR001611
216-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELDLSDNALNGSIPASLGNM

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYGNQLSGSIPEEICYL

Gene3D: G3DSA:3.80.10.10
248-463 G3DSA:3.80.10.10

GNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLY

ProfileScan: PS51450
IPR001611
264-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLSENALNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYGNQLSGSIPEEIGYL

superfamily: SSF52047
302-517 SSF52047,LRR

SIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSG

ProfileScan: PS51450
IPR001611
312-335 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLGLSENALNGSIPASLGNLK

ProfileScan: PS51450
IPR001611
336-359 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLNLVNNQLSGSIPASLGNLN

HMMPfam: PF00560
IPR001611
336-358 LRR_1
Leucine-rich repeat

NLSRLNLVNNQLSGSIPASLGNL

ProfileScan: PS51450
IPR001611
360-383 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSMLYLYNNQLSGSIPASLGNLN

HMMPfam: PF12799
360-396 LRR_4,Leucine Rich repeats (2 copies)

NLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLS

ProfileScan: PS51450
IPR001611
384-407 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSMLYLYNNQLSGSIPASLGNLN

HMMPfam: PF13855
408-467 LRR_8,Leucine rich repeat

NLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQL

ProfileScan: PS51450
IPR001611
408-430 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLYLYNNQLSGSIPEEIGYL

ProfileScan: PS51450
IPR001611
432-453 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLSNNSINGFIPASFGN

FPrintScan: PR00019
433-446 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSNNSINGF

ProfileScan: PS51450
IPR001611
456-478 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLAFLFLYENQLASSVPEEIGYL

Gene3D: G3DSA:3.80.10.10
464-683 G3DSA:3.80.10.10

ENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNL

FPrintScan: PR00019
478-491 LEURICHRPT,Leucine-rich repeat signature

LRSLNVLDLSENAL

HMMPfam: PF00560
IPR001611
480-502 LRR_1
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

ProfileScan: PS51450
IPR001611
480-502 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

HMMPfam: PF00560
IPR001611
504-524 LRR_1
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
504-526 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIGYL

superfamily: SSF52047
518-871 SSF52047,LRR

SIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTV

ProfileScan: PS51450
IPR001611
528-550 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

HMMPfam: PF00560
IPR001611
528-550 LRR_1
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

ProfileScan: PS51450
IPR001611
552-574 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIGYL

HMMPfam: PF00560
IPR001611
552-572 LRR_1
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
576-599 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNDLGLSENALNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
600-622 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSMLYLYNNQLSGSIPEEIGYL

HMMPfam: PF13855
623-683 LRR_8,Leucine rich repeat

SSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNL

ProfileScan: PS51450
IPR001611
624-645 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLSLGNNSLNGLIPASFGN

ProfileScan: PS51450
IPR001611
648-670 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQALILNDNNLIGEIPSSVCNL

Gene3D: G3DSA:3.80.10.10
687-870 G3DSA:3.80.10.10

VPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRT

HMMPfam: PF13855
695-755 LRR_8,Leucine rich repeat

SNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKL

ProfileScan: PS51450
IPR001611
696-718 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLSMSSNSFSGELPSSISNL

ProfileScan: PS51450
IPR001611
768-791 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELEDEIPRSLDNCK

HMMPfam: PF13855
768-827 LRR_8,Leucine rich repeat

SLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKL

ProfileScan: PS51450
IPR001611
792-815 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGDNQLNDTFPMWLGTLP

ProfileScan: PS51450
IPR001611
842-864 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRIIDLSRNAFSQDLPTSLFEH

HMMPfam: PF00560
IPR001611
843-865 LRR_1
Leucine-rich repeat

LRIIDLSRNAFSQDLPTSLFEHL

superfamily: SSF52058
907-1021 SSF52058,LRR

TVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGC

Gene3D: G3DSA:3.80.10.10
909-1003 G3DSA:3.80.10.10

IDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFES

ProfileScan: PS51450
IPR001611
953-976 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
954-989 LRR_4,Leucine Rich repeats (2 copies)

LESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQ

ProfileScan: PS51450
IPR001611
977-999 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEFLNLSHNYLQGCIPQGPQFR


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000032

List of References

M S Dixon, D A Jones, J S Keddie, C M Thomas, K Harrison, J D Jones
The tomato Cf-2 disease resistance locus comprises two functional genes encoding leucine-rich repeat proteins.
Cell: 1996, 84(3);451-9
PubMed:8608599 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox