PRGDB00000032 (Cf-2)

From PRG Wiki
Jump to: navigation, search
Cf-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 1184074 (U42444)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 6
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium leucine rich repeat protein Cf-2.1 gene, complete cds.

DNA Sequence

ATGATGATGGTTTCTAGAAAAGTAGTCTCTTCACTTCAGTTTTTCACTCTTTTCTACCTCTTTACAGTTGCATTTGCTTCGACTGAGGAGGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGAATAATTCCTTTTTGGCTTCATGGATTCCAAGTTCTAATGCATGCAAGGACTGGTATGGAGTTGTATGCTTTAATGGTAGGGTAAACACGTTGAATATTACAAATGCTAGTGTCATTGGTACACTCTATGCTTTTCCATTTTCATCCCTCCCTTCTCTTGAAAATCTTGATCTTAGCAAGAACAATATCTATGGTACCATTCCACCTGAGATTGGTAATCTCACAAATCTTGTCTATCTTGACTTGAACAACAATCAGATTTCAGGAACAATACCACCACAAATCGGTTTACTAGCCAAGCTTCAGATCATCCGCATATTTCACAATCAATTAAATGGATTTATTCCTAAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCCATTCCTGCTTCAGTGGGGAATCTGAACAACTTGTCTTTTTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAAGTTACCTAAGATCTCTTACTGAGCTAGATTTGAGTGATAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATATGAACAACTTGTCTTTTTTGTTTCTTTATGGAAATCAGCTTTCTGGCTCTATTCCTGAAGAAATATGTTACCTAAGATCTCTTACTTACCTAGATTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATTTGAACAACTTGTCTTTTTTGTTTCTTTATGGAAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGATCTCTTAATGTCCTAGGTTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAAAAACTTGTCTAGGTTGAATCTTGTTAATAATCAGCTTTCTGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTATGTTGTATCTTTACAATAACCAGCTTTCTGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTAGGTTGTATCTCTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACTTGAGTTCTCTTACTTATCTAGATTTGAGTAATAACTCCATTAATGGATTTATTCCTGCTTCATTTGGCAATATGAGCAACTTGGCTTTTTTGTTTCTTTATGAAAATCAGCTTGCTAGCTCTGTTCCTGAAGAAATAGGTTACCTAAGGTCTCTTAATGTCCTTGATTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTCGGGAATTTGAACAACTTGTCTAGGTTGAATCTTGTTAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTAATGTCCTTGATTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTCGGGAATTTGAACAACTTGTCTAGGTTGAATCTTGTTAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGATCTCTTAATGACCTAGGTTTGAGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACTTGAGTTCTCTTACTTATCTATCTTTGGGTAATAACTCTCTTAATGGACTTATTCCTGCTTCATTTGGCAATATGAGAAATCTGCAAGCTCTGATTCTCAATGATAACAATCTCATTGGGGAAATTCCTTCATCTGTGTGCAATTTGACATCACTGGAAGTGTTGTATATGCCGAGAAACAATTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTAACCTTCAGGTTTTGTCGATGTCATCTAATAGTTTCAGTGGAGAGCTCCCTTCATCTATTTCCAATTTAACATCACTACAAATACTTGATTTTGGCAGAAACAATCTGGAGGGAGCAATACCACAATGTTTTGGCAATATTAGTAGCCTCGAGGTTTTTGATATGCAGAACAACAAACTTTCTGGGACTCTTCCAACAAATTTTAGCATTGGATGTTCACTGATAAGTCTCAACTTGCATGGCAATGAACTAGAGGATGAAATCCCTCGGTCTTTGGACAATTGCAAAAAGCTGCAAGTTCTTGATTTAGGAGACAATCAACTCAACGACACATTTCCCATGTGGTTGGGAACTTTGCCAGAGCTGAGAGTTTTAAGGTTGACATCGAATAAATTGCATGGACCTATAAGATCATCAAGGGCTGAAATCATGTTTCCTGATCTTCGAATCATAGATCTCTCTCGCAATGCATTCTCGCAAGACTTACCAACGAGTCTATTTGAACATTTGAAAGGGATGAGGACAGTTGATAAAACAATGGAGGAACCAAGTTATGAAAGCTATTACGATGACTCGGTGGTAGTTGTGACAAAGGGATTGGAGCTTGAAATTGTGAGAATTTTGTCTTTGTACACAGTTATCGATCTTTCAAGCAACAAATTTGAAGGACATATTCCTTCTGTCCTGGGAGATCTCATTGCGATCCGTATACTTAATGTATCTCATAATGCATTGCAAGGCTATATACCATCATCACTTGGAAGTTTATCTATACTGGAATCACTAGACCTTTCGTTTAACCAACTTTCAGGAGAGATACCACAACAACTTGCTTCTCTTACGTTTCTTGAATTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGACCTCAATTCCGTACCTTTGAGAGCAATTCATATGAAGGTAATGATGGATTACGTGGATATCCAGTTTCAAAAGGTTGTGGCAAAGATCCTGTGTCAGAGAAAAACTATACAGTGTCTGCGCTAGAAGATCAAGAAAGCAATTCTGAATTTTTCAATGATTTTTGGAAAGCAGCTCTGATGGGCTATGGAAGTGGACTGTGTATTGGCATATCCATGATATATATCTTGATCTCGACTGGAAATCTAAGATGGCTTGCAAGAATCATTGAAAAACTGGAACACAAAATTATCATGCAAAGGAGAAAGAAGCAGCGAGGTCAAAGAAATTACAGAAGAAGAAATAATCACTTCTAG


Protein sequences

Name Description Sequence
Cf-2.1 Cf-2.1 [Lycopersicon pimpinellifolium].

MMMVSRKVVSSLQFFTLFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGCGKDPVSEKNYTVSALEDQESNSEFFNDFWKAALMGYGSGLCIGISMIYILISTGNLRWLARIIEKLEHKIIMQRRKKQRGQRNYRRRNNHF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1014 PTHR24420,FAMILY NOT NAMED

MMMVSRKVVSSLQFFTLFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG

superfamily: SSF52058
26-373 SSF52058,LRR

ASTEEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSG

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVC

Gene3D: G3DSA:3.80.10.10
87-247 G3DSA:3.80.10.10

YAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLY

HMMPfam: PF12799
95-132 LRR_4,Leucine Rich repeats (2 copies)

PSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQIS

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLENLDLSKNNIYGTIPPEIGNL

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNNNQISGTIPPQIGLL

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASVGNL

HMMPfam: PF00560
IPR001611
192-212 LRR_1
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIS

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEISYL

HMMPfam: PF13855
216-275 LRR_8,Leucine rich repeat

SLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENAL

ProfileScan: PS51450
IPR001611
216-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELDLSDNALNGSIPASLGNM

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYGNQLSGSIPEEICYL

Gene3D: G3DSA:3.80.10.10
248-463 G3DSA:3.80.10.10

GNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLY

ProfileScan: PS51450
IPR001611
264-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLSENALNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYGNQLSGSIPEEIGYL

superfamily: SSF52047
302-517 SSF52047,LRR

SIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSG

ProfileScan: PS51450
IPR001611
312-335 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLGLSENALNGSIPASLGNLK

ProfileScan: PS51450
IPR001611
336-359 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLNLVNNQLSGSIPASLGNLN

HMMPfam: PF00560
IPR001611
336-358 LRR_1
Leucine-rich repeat

NLSRLNLVNNQLSGSIPASLGNL

ProfileScan: PS51450
IPR001611
360-383 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSMLYLYNNQLSGSIPASLGNLN

HMMPfam: PF12799
360-396 LRR_4,Leucine Rich repeats (2 copies)

NLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLS

ProfileScan: PS51450
IPR001611
384-407 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSMLYLYNNQLSGSIPASLGNLN

HMMPfam: PF13855
408-467 LRR_8,Leucine rich repeat

NLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQL

ProfileScan: PS51450
IPR001611
408-430 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLYLYNNQLSGSIPEEIGYL

ProfileScan: PS51450
IPR001611
432-453 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLSNNSINGFIPASFGN

FPrintScan: PR00019
433-446 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSNNSINGF

ProfileScan: PS51450
IPR001611
456-478 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLAFLFLYENQLASSVPEEIGYL

Gene3D: G3DSA:3.80.10.10
464-683 G3DSA:3.80.10.10

ENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNL

FPrintScan: PR00019
478-491 LEURICHRPT,Leucine-rich repeat signature

LRSLNVLDLSENAL

HMMPfam: PF00560
IPR001611
480-502 LRR_1
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

ProfileScan: PS51450
IPR001611
480-502 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

HMMPfam: PF00560
IPR001611
504-524 LRR_1
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
504-526 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIGYL

superfamily: SSF52047
518-871 SSF52047,LRR

SIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTV

ProfileScan: PS51450
IPR001611
528-550 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

HMMPfam: PF00560
IPR001611
528-550 LRR_1
Leucine-rich repeat

SLNVLDLSENALNGSIPASFGNL

ProfileScan: PS51450
IPR001611
552-574 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIGYL

HMMPfam: PF00560
IPR001611
552-572 LRR_1
Leucine-rich repeat

NLSRLNLVNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
576-599 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNDLGLSENALNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
600-622 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSMLYLYNNQLSGSIPEEIGYL

HMMPfam: PF13855
623-683 LRR_8,Leucine rich repeat

SSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNL

ProfileScan: PS51450
IPR001611
624-645 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLSLGNNSLNGLIPASFGN

ProfileScan: PS51450
IPR001611
648-670 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQALILNDNNLIGEIPSSVCNL

Gene3D: G3DSA:3.80.10.10
687-870 G3DSA:3.80.10.10

VPQCLGNISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRT

HMMPfam: PF13855
695-755 LRR_8,Leucine rich repeat

SNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKL

ProfileScan: PS51450
IPR001611
696-718 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLSMSSNSFSGELPSSISNL

ProfileScan: PS51450
IPR001611
768-791 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELEDEIPRSLDNCK

HMMPfam: PF13855
768-827 LRR_8,Leucine rich repeat

SLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKL

ProfileScan: PS51450
IPR001611
792-815 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGDNQLNDTFPMWLGTLP

ProfileScan: PS51450
IPR001611
842-864 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRIIDLSRNAFSQDLPTSLFEH

HMMPfam: PF00560
IPR001611
843-865 LRR_1
Leucine-rich repeat

LRIIDLSRNAFSQDLPTSLFEHL

superfamily: SSF52058
907-1021 SSF52058,LRR

TVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGC

Gene3D: G3DSA:3.80.10.10
909-1003 G3DSA:3.80.10.10

IDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFES

ProfileScan: PS51450
IPR001611
953-976 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
954-989 LRR_4,Leucine Rich repeats (2 copies)

LESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQ

ProfileScan: PS51450
IPR001611
977-999 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEFLNLSHNYLQGCIPQGPQFR


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000032

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox