PRGDB00000033 (Cf-4)

From PRG Wiki
Jump to: navigation, search
Cf-4
Gene Type Reference_R-Genes,_manually_curated
GenBank 2808679 (AJ002235)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 1
Gene Species Solanum habrochaites

Comment?

Lycopersicon hirsutum Cf-4 resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTAGAATTCAAGAACATGTTTACCGTTAATCCTAATGCTTCTGATTATTGTTACGACAGAAGAACTCTTTCTTGGAACAAAAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAAACGACAGGACAAGTGATTGAGCTTGACCTCCGTTGCATCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTTATAATGATTTCACTGGATCGCCCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGCATTCAAGTTTTAGGGGTGTAATCCCTTCTGAAATCTCTCATCTTTCTAAACTATACGTTCTTCGTATTAGTCTAAATGAGCTTACTTTTGGTCCTCACAATTTTGAATTGCTTCTTAAGAACTTGACCCAATTAAAAGTGCTCGACCTTGAATCTATCAACATCTCTTCCACTATTCCTTTGAATTTCTCTTCTCATTTAACAAATCTATGGCTTCCATACACAGAGTTACGTGGGATATTGCCCGAAAGAGTTTTCCACCTTTCCGACTTAGAATTTCTCGATTTATCAAGCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATATCTCTATAATGTGAATATTGATGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATAAGTTGTACATGAGTCGTTCTAATCTGTCAGGGCCTATTCCTAAACCTCTATGGAATCTCACCAACATAGTGTTTTTGGACCTTAATAATAACCATCTTGAAGGACCAATTCCATCCAACGTAAGCGGACTACGTAACCTACAAATACTTTGGTTGTCATCAAACAACTTAAATGGGAGTATACCATCCTGGATATTCTCCCTTCCATCACTGATAGGGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTACCGTTACTCTAAAACAAAATAAGCTAAAAGGTCCTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAATTCCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCGCAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATTTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGGAAATTGATGAGAGTACAGGATTCCCAGAGTATATTTCTGATCCATATGATATTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTCGAATTTTGGATTCTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGAAGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAAAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Cf-4 Cf-4 [Solanum habrochaites].

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-729 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPanther: PTHR24420
1-729 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

Gene3D: G3DSA:3.80.10.10
28-248 G3DSA:3.80.10.10

CPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTT

HMMPfam: PF08263
IPR013210
30-76 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCD

superfamily: SSF52047
84-409 SSF52047,LRR

ELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNIS

HMMPfam: PF13516
105-119 LRR_6,Leucine Rich repeat

LSNLKRLDLSYNDFT

ProfileScan: PS51450
IPR001611
107-128 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLDLSYNDFTGSPISPKFG

HMMPfam: PF00560
IPR001611
133-154 LRR_1
Leucine-rich repeat

LTHLDLSHSSFRGVIPSEISHL

ProfileScan: PS51450
IPR001611
156-177 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYVLRISLNELTFGPHNFELL

ProfileScan: PS51450
IPR001611
183-204 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKVLDLESINISSTIPLNFSS

Gene3D: G3DSA:3.80.10.10
251-455 G3DSA:3.80.10.10

NSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNN

ProfileScan: PS51450
IPR001611
255-277 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLMKLYLYNVNIDDRIPESFSHL

ProfileScan: PS51450
IPR001611
303-326 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIVFLDLNNNHLEGPIPSNVSGLR

ProfileScan: PS51450
IPR001611
327-349 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQILWLSSNNLNGSIPSWIFSL

HMMPfam: PF00560
IPR001611
327-348 LRR_1
Leucine-rich repeat

NLQILWLSSNNLNGSIPSWIFS

ProfileScan: PS51450
IPR001611
351-373 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIGLDLSNNTFSGKIQEFKSKT

superfamily: SSF52058
372-717 SSF52058,LRR

KTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMPfam: PF13516
396-418 LRR_6,Leucine Rich repeat

KNLQFLLLSHNNISGHISSAICN

ProfileScan: PS51450
IPR001611
397-420 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQFLLLSHNNISGHISSAICNLK

ProfileScan: PS51450
IPR001611
446-467 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLSHLDLSNNRLSGTINTTFSV

HMMPfam: PF13855
446-505 LRR_8,Leucine rich repeat

YLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
447-460 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNRLSGT

Gene3D: G3DSA:3.80.10.10
456-572 G3DSA:3.80.10.10

RLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKE

ProfileScan: PS51450
IPR001611
494-516 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTLLDLGNNMLNDTFPNWLGYL

ProfileScan: PS51450
IPR001611
518-539 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKILSLRSNKLHGPIKSSGNT

ProfileScan: PS51450
IPR001611
544-565 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQILDLSSNGFSGNLPERILG

HMMPfam: PF00560
IPR001611
545-567 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPERILGNL

Gene3D: G3DSA:3.80.10.10
616-726 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

HMMPfam: PF13855
636-695 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
636-659 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRTLNLSHNVLEGHIPASFQNLS

ProfileScan: PS51450
IPR001611
660-683 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLESLDLSSNKISGEIPQQLASLT

FPrintScan: PR00019
682-695 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
684-706 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLNLSHNHLVGCIPKGKQFD


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000033

List of References

M Parniske, K E Hammond-Kosack, C Golstein, C M Thomas, D A Jones, K Harrison, B B Wulff, J D Jones
Novel disease resistance specificities result from sequence exchange between tandemly repeated genes at the Cf-4/9 locus of tomato.
Cell: 1997, 91(6);821-32
PubMed:9413991 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox