PRGDB00000034 (Cf4A)

From PRG Wiki
Jump to: navigation, search
Cf4A
Gene Type Reference_R-Genes,_manually_curated
GenBank 2808679 (AJ002235)
Gene Class RLP
Domain Type LRR, LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase
Chromosome 1
Gene Species Solanum habrochaites

Comment?

Lycopersicon hirsutum Cf-4 resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTATATTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACATGTTTACCATTAATCCTAATGCTTCTAATTATTGTTACGACAGAAGAACTCTTTCTTGGAACAAAAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGAGCTTGATCTCGGTTGCAGCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTTCTAATGATTTCACTGGATCGCCCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGGATTCTAATTTTACGGGTGTAATCCCTTCTGAAATCTCTCACCTTTCTAAACTACACGTTCTTCGTATCAGTGATCAATATAAGCTTAGTCTTGGGCCTCACAATTTTGAATTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCCACCTTGAATCTGTCAACATCTCTTCCACCATTCCTTCCAATTTCTCCTTTCATTTAACAAATCTACGGCTTTCATACACAGAGTTACGTGGGGTATTGCCCGAAAGAGTTTTCCACCTTTCCAACTTAGAATTGCTAGATTTATCATATAATCCCCAGCTCACGGTTAGGTTTCCCACAACCATATGGAATAGCAGTGCATCACTCGTGAAGTTATATCTCAGTCGTGTGAATATTGCTGGTAATATACCTGATTCATTTAGCTATCTAACTGCACTTCATGAGTTGGACATGGTTTATACTAATCTATCAGGGCCTATTCCTAAACCTTTATGGAATCTCACCAACATTGAGAGTTTGGACCTTGATTATAACCATCTTGAAGGACCAATTCCCCAGCTCCCAATATTTGAAAAGCTCAAGAGTTTAACACTTGGAAATAACAATTTGGATGGCGGACTTGAGTTCTTATCCTTTAACAGAAGCTGGACCCAACTTGAAGAATTAGATTTTTCATCCAATTCCCTAACTGGTCCAATTCCATCCAACGTAAGCGGACTGCGAAATCTACAATCACTCTACTTGTCATCAAACAACTTGAATGGGAGTATACCTTCCTGGATATTCGATCTTCCGTCACTAAGATCTTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTATCGTTACTCTAAAACAAAATCAGCTGAAAGGTCCTATTCCGAATTCACTCCTAAACCAGGAGAGCCTACAATTCCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCATCTATCTGCAATTTGAAAATATTGATGGTGTTAGACTTGGGAAGTAACAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTATTGGAAACTCTTTCAGGGCCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTTTGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATCAGTTGAATGACACATTTCCAAACTGGTTGGGCTACCTATCTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACCTGTTTATGCGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGAAATTTGATGAGAATACAAGATTCCCAGAGTATATTTCTGATCGATATATTTATTATGATTATTTGACGACAATTACTACAAAGGGACAAGATTATGATTCTGTTAGAATTTTTACTTTTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCGTATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGTATCATTGCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGCAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTGGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAACACATTGTGGCGGTGATGATCAAGTGACAACTCCAGCGGAGCTAGATCAACAACAAGAAGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCATGGGTTACGGTTGTGGACTTGTTATTGGTTTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACGCATAATTACTACGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Hcr9-4E Hcr9-4E [Solanum habrochaites].

MGCVKLIFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSTHCGGDDQVTTPAELDQQQEEEDSPMISWQGVLMGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLERIITTRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-775 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MGCVKLIFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLST

HMMPanther: PTHR24420
1-775 FAMILY NOT NAMED,FAMILY NOT NAMED

MGCVKLIFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLST

Seg: seg
11-24 seg

LYVFLFQLVSSSSL

Gene3D: G3DSA:3.80.10.10
28-334 no description

CPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLG

HMMPfam: PF08263
IPR013210
30-76 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCD

superfamily: SSF52047
84-413 RNI-like,LRR

ELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFS

HMMSmart: SM00369
IPR003591
105-130 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLKRLDLSSNDFTGSPISPKFGEF

HMMPfam: PF13504
106-120 LRR_7,Leucine rich repeat

SNLKRLDLSSNDFTG

HMMPfam: PF00560
IPR001611
133-154 LRR_1
Leucine-rich repeat

LTHLDLSDSNFTGVIPSEISHL

HMMSmart: SM00369
IPR003591
182-206 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTQLRELHLESVNISSTIPSNFSFH

HMMSmart: SM00369
IPR003591
228-253 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLELLDLSYNPQLTVRFPTTIWNS

HMMPfam: PF00560
IPR001611
230-249 LRR_1
Leucine-rich repeat

NLELLDLSYNPQLTVRFPTT

HMMSmart: SM00369
IPR003591
302-327 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNIESLDLDYNHLEGPIPQLPIFEK

Seg: seg
333-342 seg

LGNNNLDGGL

Gene3D: G3DSA:3.80.10.10
335-505 no description

NNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNN

superfamily: SSF52058
349-766 L domain-like,LRR

RSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMPfam: PF13855
353-410 LRR_8,Leucine rich repeat

QLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNN

HMMSmart: SM00369
IPR003591
375-399 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLQSLYLSSNNLNGSIPSWIFDL

Seg: seg
377-391 seg

NLQSLYLSSNNLNGS

Seg: seg
440-466 seg

NSLLNQESLQFLLLSHNNISGHISSSI

HMMPfam: PF00560
IPR001611
447-469 LRR_1
Leucine-rich repeat

SLQFLLLSHNNISGHISSSICNL

HMMSmart: SM00369
IPR003591
469-493 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKILMVLDLGSNNLEGTIPQCVVER

HMMPfam: PF00560
IPR001611
497-513 LRR_1
Leucine-rich repeat

LSHLDLSNNRLSGTINT

FPrintScan: PR00019
497-510 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNRLSGT

HMMPfam: PF13516
542-562 LRR_6,Leucine Rich repeat

CKYLTLLDLGNNQLNDTFPNW

HMMSmart: SM00369
IPR003591
592-616 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FMRLQILDLSSNGFSGNLPERILGN

HMMPfam: PF00560
IPR001611
594-617 LRR_1
Leucine-rich repeat

RLQILDLSSNGFSGNLPERILGNL

Seg: seg
637-648 seg

YIYYDYLTTITT

Gene3D: G3DSA:3.80.10.10
664-774 no description

IINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLS

HMMSmart: SM00369
IPR003591
683-706 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVGLRTLNLSHNVLEGHIPVSLQN

HMMPfam: PF13855
685-744 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHL

HMMSmart: SM00369
IPR003591
707-730 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSVLESLDLSSNKISGAIPQQLAS

FPrintScan: PR00019
731-744 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

HMMSmart: SM00369
IPR003591
731-756 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLEVLNLSHNHLVGCIPKGKQFDS


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000034

List of References

M Parniske, K E Hammond-Kosack, C Golstein, C M Thomas, D A Jones, K Harrison, B B Wulff, J D Jones
Novel disease resistance specificities result from sequence exchange between tandemly repeated genes at the Cf-4/9 locus of tomato.
Cell: 1997, 91(6);821-32
PubMed:9413991 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox