PRGDB00000034 (Cf4A)

From PRG Wiki
Jump to: navigation, search
Cf4A
Gene Type Reference_R-Genes,_manually_curated
GenBank 2808679 (AJ002235)
Gene Class RLP
Domain Type LRR, LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase
Chromosome 1
Gene Species Solanum habrochaites

Comment?

Lycopersicon hirsutum Cf-4 resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTATATTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACATGTTTACCATTAATCCTAATGCTTCTAATTATTGTTACGACAGAAGAACTCTTTCTTGGAACAAAAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGAGCTTGATCTCGGTTGCAGCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTTCTAATGATTTCACTGGATCGCCCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGGATTCTAATTTTACGGGTGTAATCCCTTCTGAAATCTCTCACCTTTCTAAACTACACGTTCTTCGTATCAGTGATCAATATAAGCTTAGTCTTGGGCCTCACAATTTTGAATTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCCACCTTGAATCTGTCAACATCTCTTCCACCATTCCTTCCAATTTCTCCTTTCATTTAACAAATCTACGGCTTTCATACACAGAGTTACGTGGGGTATTGCCCGAAAGAGTTTTCCACCTTTCCAACTTAGAATTGCTAGATTTATCATATAATCCCCAGCTCACGGTTAGGTTTCCCACAACCATATGGAATAGCAGTGCATCACTCGTGAAGTTATATCTCAGTCGTGTGAATATTGCTGGTAATATACCTGATTCATTTAGCTATCTAACTGCACTTCATGAGTTGGACATGGTTTATACTAATCTATCAGGGCCTATTCCTAAACCTTTATGGAATCTCACCAACATTGAGAGTTTGGACCTTGATTATAACCATCTTGAAGGACCAATTCCCCAGCTCCCAATATTTGAAAAGCTCAAGAGTTTAACACTTGGAAATAACAATTTGGATGGCGGACTTGAGTTCTTATCCTTTAACAGAAGCTGGACCCAACTTGAAGAATTAGATTTTTCATCCAATTCCCTAACTGGTCCAATTCCATCCAACGTAAGCGGACTGCGAAATCTACAATCACTCTACTTGTCATCAAACAACTTGAATGGGAGTATACCTTCCTGGATATTCGATCTTCCGTCACTAAGATCTTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTATCGTTACTCTAAAACAAAATCAGCTGAAAGGTCCTATTCCGAATTCACTCCTAAACCAGGAGAGCCTACAATTCCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCATCTATCTGCAATTTGAAAATATTGATGGTGTTAGACTTGGGAAGTAACAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTATTGGAAACTCTTTCAGGGCCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTTTGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATCAGTTGAATGACACATTTCCAAACTGGTTGGGCTACCTATCTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACCTGTTTATGCGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGAAATTTGATGAGAATACAAGATTCCCAGAGTATATTTCTGATCGATATATTTATTATGATTATTTGACGACAATTACTACAAAGGGACAAGATTATGATTCTGTTAGAATTTTTACTTTTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCGTATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGTATCATTGCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGCAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTGGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAACACATTGTGGCGGTGATGATCAAGTGACAACTCCAGCGGAGCTAGATCAACAACAAGAAGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCATGGGTTACGGTTGTGGACTTGTTATTGGTTTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACGCATAATTACTACGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Hcr9-4E Hcr9-4E [Solanum habrochaites].

MGCVKLIFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSTHCGGDDQVTTPAELDQQQEEEDSPMISWQGVLMGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLERIITTRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-775 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MGCVKLIFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLST

HMMPanther: PTHR24420
1-775 FAMILY NOT NAMED,FAMILY NOT NAMED

MGCVKLIFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLST

Seg: seg
11-24 seg

LYVFLFQLVSSSSL

Gene3D: G3DSA:3.80.10.10
28-334 no description

CPEDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLG

HMMPfam: PF08263
IPR013210
30-76 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNMFTINPNASNYCYDRRTLSWNKSTSCCSWDGVHCD

superfamily: SSF52047
84-413 RNI-like,LRR

ELDLGCSQLQGKFHSNSSLFQLSNLKRLDLSSNDFTGSPISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRISDQYKLSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSFHLTNLRLSYTELRGVLPERVFHLSNLELLDLSYNPQLTVRFPTTIWNSSASLVKLYLSRVNIAGNIPDSFSYLTALHELDMVYTNLSGPIPKPLWNLTNIESLDLDYNHLEGPIPQLPIFEKLKSLTLGNNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFS

HMMSmart: SM00369
IPR003591
105-130 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLKRLDLSSNDFTGSPISPKFGEF

HMMPfam: PF13504
106-120 LRR_7,Leucine rich repeat

SNLKRLDLSSNDFTG

HMMPfam: PF00560
IPR001611
133-154 LRR_1
Leucine-rich repeat

LTHLDLSDSNFTGVIPSEISHL

HMMSmart: SM00369
IPR003591
182-206 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTQLRELHLESVNISSTIPSNFSFH

HMMSmart: SM00369
IPR003591
228-253 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLELLDLSYNPQLTVRFPTTIWNS

HMMPfam: PF00560
IPR001611
230-249 LRR_1
Leucine-rich repeat

NLELLDLSYNPQLTVRFPTT

HMMSmart: SM00369
IPR003591
302-327 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNIESLDLDYNHLEGPIPQLPIFEK

Seg: seg
333-342 seg

LGNNNLDGGL

Gene3D: G3DSA:3.80.10.10
335-505 no description

NNNLDGGLEFLSFNRSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNN

superfamily: SSF52058
349-766 L domain-like,LRR

RSWTQLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNNTFSGKIQEFKSKTLSIVTLKQNQLKGPIPNSLLNQESLQFLLLSHNNISGHISSSICNLKILMVLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKFDENTRFPEYISDRYIYYDYLTTITTKGQDYDSVRIFTFNMIINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMPfam: PF13855
353-410 LRR_8,Leucine rich repeat

QLEELDFSSNSLTGPIPSNVSGLRNLQSLYLSSNNLNGSIPSWIFDLPSLRSLDLSNN

HMMSmart: SM00369
IPR003591
375-399 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLQSLYLSSNNLNGSIPSWIFDL

Seg: seg
377-391 seg

NLQSLYLSSNNLNGS

Seg: seg
440-466 seg

NSLLNQESLQFLLLSHNNISGHISSSI

HMMPfam: PF00560
IPR001611
447-469 LRR_1
Leucine-rich repeat

SLQFLLLSHNNISGHISSSICNL

HMMSmart: SM00369
IPR003591
469-493 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKILMVLDLGSNNLEGTIPQCVVER

HMMPfam: PF00560
IPR001611
497-513 LRR_1
Leucine-rich repeat

LSHLDLSNNRLSGTINT

FPrintScan: PR00019
497-510 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNRLSGT

HMMPfam: PF13516
542-562 LRR_6,Leucine Rich repeat

CKYLTLLDLGNNQLNDTFPNW

HMMSmart: SM00369
IPR003591
592-616 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FMRLQILDLSSNGFSGNLPERILGN

HMMPfam: PF00560
IPR001611
594-617 LRR_1
Leucine-rich repeat

RLQILDLSSNGFSGNLPERILGNL

Seg: seg
637-648 seg

YIYYDYLTTITT

Gene3D: G3DSA:3.80.10.10
664-774 no description

IINLSKNRFEGRIPSIIGDLVGLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLS

HMMSmart: SM00369
IPR003591
683-706 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVGLRTLNLSHNVLEGHIPVSLQN

HMMPfam: PF13855
685-744 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPVSLQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHL

HMMSmart: SM00369
IPR003591
707-730 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSVLESLDLSSNKISGAIPQQLAS

FPrintScan: PR00019
731-744 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

HMMSmart: SM00369
IPR003591
731-756 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLEVLNLSHNHLVGCIPKGKQFDS


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000034

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox