PRGDB00000035 (Cf-5)

From PRG Wiki
Jump to: navigation, search
Cf-5
Gene Type Reference_R-Genes,_manually_curated
GenBank 3894382 (AF053993)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 6
Gene Species Solanum lycopersicum var. cerasiforme

Comment?

Lycopersicon esculentum disease resistance protein (Cf-5) gene, complete cds.

DNA Sequence

ATGATGATGGTTACTAGCAAAGTATTCTCTTCACTTCAGTTTTTCACTGTTTTCTACCTCTTTACAGTTGCATTTGCTTCGACTGAGGAGGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGAATAATTCCTTTTTGGCTTCATGGACGACAAGTTCTAATGCATGCAAGGACTGGTATGGAGTTGTATGCTTGAATGGTAGGGTAAACACGTTGAATATTACAAATGCCAGTGTCATTGGTACACTTTATGCTTTTCCATTTTCATCCCTCCCTTTTCTCGAGAATCTTGATCTTAGCAACAACAATATCTCTGGTACCATTCCACCTGAGATTGGTAATCTCACAAATCTTGTCTATCTTGACTTGAACACCAATCAGATTTCAGGAACAATTCCACCACAAATCGGTTCACTAGCCAAGCTTCAGATCATCCGCATATTTAACAATCATTTAAATGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCTATTCCTGCTTCATTGGGCAATATGACCAACTTGTCTTTTTTATTTCTTTATGAAAATCAGCTTTCTGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGATATCAACTTTCTTAGTGGTTCCATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTTTTTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCACTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCCATTCCTGCTTCATTGGGGAATCTAAACAACTTGTCTAGGTTGGATCTTTACAATAATAAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTTACCTAGATTTGGGTGAGAATGCTCTTAATGGCTCTATTCCTTCTTCATTGGGGAATCTAAACAACTTGTCTAGGTTGGATCTTTACAATAATAAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTTACCTAGATTTGGGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTTTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTGAGTTCTCTTACTGAACTATATTTGGGTAATAACTCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTTTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTGAGTTCTCTTACTGAACTATTTTTGGGTAATAACTCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTAAACAACTTGTCTAGGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGCTTCATTTGGCAATATGAGAAATCTGCAAACTCTGTTTCTCAGTGATAACGATCTCATTGGGGAAATTCCTTCATTTGTGTGCAATTTGACATCACTGGAAGTGTTGTATATGTCGAGAAACAATTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTGACCTTCACATTTTGTCGATGTCATCTAATAGTTTCAGAGGAGAGCTCCCTTCATCTATTTCCAATTTAACATCACTAAAAATACTTGATTTTGGCAGAAACAATCTGGAGGGAGCAATACCACAATTTTTTGGCAATATTAGTAGCCTCCAGGTTTTTGATATGCAGAATAACAAACTTTCTGGGACTCTTCCAACAAATTTTAGCATTGGATGTTCACTGATAAGTCTCAACTTGCATGGCAATGAACTAGCAGATGAAATCCCTCGGTCTTTGGACAATTGCAAAAAGCTGCAAGTTCTTGATTTAGGAGACAATCAACTCAACGACACATTTCCCATGTGGTTGGGAACTTTGCCAGAGCTGAGAGTTTTAAGGTTGACATCGAATAAATTGCATGGACCTATAAGATCATCAGGGGCTGAAATCATGTTTCCTGATCTCCGAATCATAGATCTCTCTCGCAATGCATTCTCGCAAGACTTACCAACGAGTCTATTTGAACATTTGAAAGGGATGAGGACAGTTGATAAAACAATGGAGGAACCAAGTTATGAAAGCTATTACGATGACTCGGTGGTAGTTGTGACAAAGGGATTGGAGCTTGAAATTGTGAGAATTCTGTCTTTGTACACAATTATCGATCTTTCAAGCAACAAATTTGAAGGACATATTCCTTCTGTCCTGGGAGATCTCATTGCGATCCGTGTACTTAATGTATCTCATAATGCATTGCAAGGCTATATACCATCATCACTTGGAAGTTTATCTATACTGGAATCACTAGACCTTTCGTTTAACCAACTTTCGGGAGAGATACCACAACAACTTGCTTCTCTTACGTTTCTTGAAGTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGACCTCAATTCCGTACCTTTGAGAGCAATTCATATGAAGGTAATGATGGATTACGTGGATATCCAGTTTCAAAAGGTTGTGGCAAAGATCCTGTGTCAGAGAAAAACTATACAGTGTCTGCGCTAGAAGATCAAGAAAGCAATTCTGAATTTTTCAATGATTTTTGGAAAGCAGCTCTGATGGGCTATGGAAGTGGACTGTGTATTGGCATATCCATAATATATATCTTGATCTCGACTGGAAATCTAAGATGGCTTGCAAGAATCATTGAAGAACTGGAACACAAAATTATCGTGCAAAGGAGAAAGAAGCAGCGAGGTCAAAGAAATTACAGAAGAAGAAATAATCGCTTCTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Lycopersicon esculentum].

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGCGKDPVSEKNYTVSALEDQESNSEFFNDFWKAALMGYGSGLCIGISIIYILISTGNLRWLARIIEELEHKIIVQRRKKQRGQRNYRRRNNRF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-846 PTHR24420:SF474,SUBFAMILY NOT NAMED

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQG

HMMPanther: PTHR24420
1-846 PTHR24420,FAMILY NOT NAMED

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQG

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVC

Gene3D: G3DSA:3.80.10.10
29-298 G3DSA:3.80.10.10

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNK

superfamily: SSF52047
74-372 SSF52047,LRR

TLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALN

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLENLDLSNNNISGTIPPEIGNL

HMMPfam: PF12799
97-132 LRR_4,Leucine Rich repeats (2 copies)

LENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQIS

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNTNQISGTIPPQIGSL

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASLGNM

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYENQLSGFIPEEIGYL

ProfileScan: PS51450
IPR001611
216-239 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLDINFLSGSIPASLGNLN

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIGYL

HMMPfam: PF00560
IPR001611
240-260 LRR_1
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
264-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASLGNLN

HMMPfam: PF00560
IPR001611
288-308 LRR_1
Leucine-rich repeat

NLSRLDLYNNKLSGSIPEEIG

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLDLYNNKLSGSIPEEIGYL

Gene3D: G3DSA:3.80.10.10
299-507 G3DSA:3.80.10.10

LSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQT

HMMPfam: PF12799
312-348 LRR_4,Leucine Rich repeats (2 copies)

SLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLS

ProfileScan: PS51450
IPR001611
312-335 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLGENALNGSIPSSLGNLN

ProfileScan: PS51450
IPR001611
336-358 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLDLYNNKLSGSIPEEIGYL

HMMPfam: PF12799
360-396 LRR_4,Leucine Rich repeats (2 copies)

SLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLS

ProfileScan: PS51450
IPR001611
360-383 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLGENALNGSIPASLGNLN

superfamily: SSF52047
374-684 SSF52047,LRR

SIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLH

ProfileScan: PS51450
IPR001611
384-406 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFMLYLYNNQLSGSIPEEIGYL

ProfileScan: PS51450
IPR001611
408-431 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELYLGNNSLNGSIPASLGNLN

HMMPfam: PF12799
408-444 LRR_4,Leucine Rich repeats (2 copies)

SLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLS

ProfileScan: PS51450
IPR001611
432-454 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFMLYLYNNQLSGSIPEEIGYL

HMMPfam: PF13855
455-515 LRR_8,Leucine rich repeat

SSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDL

ProfileScan: PS51450
IPR001611
456-479 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELFLGNNSLNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
480-502 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLYLYNNQLSGSIPASFGNM

ProfileScan: PS51450
IPR001611
504-526 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLFLSDNDLIGEIPSFVCNL

Gene3D: G3DSA:3.80.10.10
508-726 G3DSA:3.80.10.10

LFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRT

ProfileScan: PS51450
IPR001611
528-550 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLYMSRNNLKGKVPQCLGNI

HMMPfam: PF00560
IPR001611
528-548 LRR_1
Leucine-rich repeat

SLEVLYMSRNNLKGKVPQCLG

HMMPfam: PF13855
553-611 LRR_8,Leucine rich repeat

LHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKL

ProfileScan: PS51450
IPR001611
576-598 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILDFGRNNLEGAIPQFFGNI

HMMPfam: PF13855
624-683 LRR_8,Leucine rich repeat

SLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKL

ProfileScan: PS51450
IPR001611
624-647 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELADEIPRSLDNCK

ProfileScan: PS51450
IPR001611
648-671 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGDNQLNDTFPMWLGTLP

ProfileScan: PS51450
IPR001611
698-720 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRIIDLSRNAFSQDLPTSLFEH

HMMPfam: PF00560
IPR001611
699-721 LRR_1
Leucine-rich repeat

LRIIDLSRNAFSQDLPTSLFEHL

superfamily: SSF52058
763-877 SSF52058,LRR

TIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGC

Gene3D: G3DSA:3.80.10.10
763-872 G3DSA:3.80.10.10

TIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYP

HMMPfam: PF00560
IPR001611
786-807 LRR_1
Leucine-rich repeat

IRVLNVSHNALQGYIPSSLGSL

ProfileScan: PS51450
IPR001611
809-832 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
810-845 LRR_4,Leucine Rich repeats (2 copies)

LESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQ

FPrintScan: PR00019
810-823 LEURICHRPT,Leucine-rich repeat signature

LESLDLSFNQLSGE

FPrintScan: PR00019
831-844 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNYL

ProfileScan: PS51450
IPR001611
833-855 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLNLSHNYLQGCIPQGPQFR


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox