PRGDB00000035 (Cf-5)

From PRG Wiki
Jump to: navigation, search
Cf-5
Gene Type Reference_R-Genes,_manually_curated
GenBank 3894382 (AF053993)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 6
Gene Species Solanum lycopersicum var. cerasiforme

Comment?

Lycopersicon esculentum disease resistance protein (Cf-5) gene, complete cds.

DNA Sequence

ATGATGATGGTTACTAGCAAAGTATTCTCTTCACTTCAGTTTTTCACTGTTTTCTACCTCTTTACAGTTGCATTTGCTTCGACTGAGGAGGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGAATAATTCCTTTTTGGCTTCATGGACGACAAGTTCTAATGCATGCAAGGACTGGTATGGAGTTGTATGCTTGAATGGTAGGGTAAACACGTTGAATATTACAAATGCCAGTGTCATTGGTACACTTTATGCTTTTCCATTTTCATCCCTCCCTTTTCTCGAGAATCTTGATCTTAGCAACAACAATATCTCTGGTACCATTCCACCTGAGATTGGTAATCTCACAAATCTTGTCTATCTTGACTTGAACACCAATCAGATTTCAGGAACAATTCCACCACAAATCGGTTCACTAGCCAAGCTTCAGATCATCCGCATATTTAACAATCATTTAAATGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCTATTCCTGCTTCATTGGGCAATATGACCAACTTGTCTTTTTTATTTCTTTATGAAAATCAGCTTTCTGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGATATCAACTTTCTTAGTGGTTCCATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTTTTTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCACTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCCATTCCTGCTTCATTGGGGAATCTAAACAACTTGTCTAGGTTGGATCTTTACAATAATAAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTTACCTAGATTTGGGTGAGAATGCTCTTAATGGCTCTATTCCTTCTTCATTGGGGAATCTAAACAACTTGTCTAGGTTGGATCTTTACAATAATAAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTTACCTAGATTTGGGTGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTTTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTGAGTTCTCTTACTGAACTATATTTGGGTAATAACTCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTTTATGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTGAGTTCTCTTACTGAACTATTTTTGGGTAATAACTCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTAAACAACTTGTCTAGGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGCTTCATTTGGCAATATGAGAAATCTGCAAACTCTGTTTCTCAGTGATAACGATCTCATTGGGGAAATTCCTTCATTTGTGTGCAATTTGACATCACTGGAAGTGTTGTATATGTCGAGAAACAATTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTGACCTTCACATTTTGTCGATGTCATCTAATAGTTTCAGAGGAGAGCTCCCTTCATCTATTTCCAATTTAACATCACTAAAAATACTTGATTTTGGCAGAAACAATCTGGAGGGAGCAATACCACAATTTTTTGGCAATATTAGTAGCCTCCAGGTTTTTGATATGCAGAATAACAAACTTTCTGGGACTCTTCCAACAAATTTTAGCATTGGATGTTCACTGATAAGTCTCAACTTGCATGGCAATGAACTAGCAGATGAAATCCCTCGGTCTTTGGACAATTGCAAAAAGCTGCAAGTTCTTGATTTAGGAGACAATCAACTCAACGACACATTTCCCATGTGGTTGGGAACTTTGCCAGAGCTGAGAGTTTTAAGGTTGACATCGAATAAATTGCATGGACCTATAAGATCATCAGGGGCTGAAATCATGTTTCCTGATCTCCGAATCATAGATCTCTCTCGCAATGCATTCTCGCAAGACTTACCAACGAGTCTATTTGAACATTTGAAAGGGATGAGGACAGTTGATAAAACAATGGAGGAACCAAGTTATGAAAGCTATTACGATGACTCGGTGGTAGTTGTGACAAAGGGATTGGAGCTTGAAATTGTGAGAATTCTGTCTTTGTACACAATTATCGATCTTTCAAGCAACAAATTTGAAGGACATATTCCTTCTGTCCTGGGAGATCTCATTGCGATCCGTGTACTTAATGTATCTCATAATGCATTGCAAGGCTATATACCATCATCACTTGGAAGTTTATCTATACTGGAATCACTAGACCTTTCGTTTAACCAACTTTCGGGAGAGATACCACAACAACTTGCTTCTCTTACGTTTCTTGAAGTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGACCTCAATTCCGTACCTTTGAGAGCAATTCATATGAAGGTAATGATGGATTACGTGGATATCCAGTTTCAAAAGGTTGTGGCAAAGATCCTGTGTCAGAGAAAAACTATACAGTGTCTGCGCTAGAAGATCAAGAAAGCAATTCTGAATTTTTCAATGATTTTTGGAAAGCAGCTCTGATGGGCTATGGAAGTGGACTGTGTATTGGCATATCCATAATATATATCTTGATCTCGACTGGAAATCTAAGATGGCTTGCAAGAATCATTGAAGAACTGGAACACAAAATTATCGTGCAAAGGAGAAAGAAGCAGCGAGGTCAAAGAAATTACAGAAGAAGAAATAATCGCTTCTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Lycopersicon esculentum].

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGCGKDPVSEKNYTVSALEDQESNSEFFNDFWKAALMGYGSGLCIGISIIYILISTGNLRWLARIIEELEHKIIVQRRKKQRGQRNYRRRNNRF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-846 PTHR24420:SF474,SUBFAMILY NOT NAMED

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQG

HMMPanther: PTHR24420
1-846 PTHR24420,FAMILY NOT NAMED

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYDDSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQG

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVC

Gene3D: G3DSA:3.80.10.10
29-298 G3DSA:3.80.10.10

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNK

superfamily: SSF52047
74-372 SSF52047,LRR

TLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALN

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLENLDLSNNNISGTIPPEIGNL

HMMPfam: PF12799
97-132 LRR_4,Leucine Rich repeats (2 copies)

LENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQIS

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNTNQISGTIPPQIGSL

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASLGNM

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYENQLSGFIPEEIGYL

ProfileScan: PS51450
IPR001611
216-239 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLDINFLSGSIPASLGNLN

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIGYL

HMMPfam: PF00560
IPR001611
240-260 LRR_1
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
264-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASLGNLN

HMMPfam: PF00560
IPR001611
288-308 LRR_1
Leucine-rich repeat

NLSRLDLYNNKLSGSIPEEIG

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLDLYNNKLSGSIPEEIGYL

Gene3D: G3DSA:3.80.10.10
299-507 G3DSA:3.80.10.10

LSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQT

HMMPfam: PF12799
312-348 LRR_4,Leucine Rich repeats (2 copies)

SLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNKLS

ProfileScan: PS51450
IPR001611
312-335 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLGENALNGSIPSSLGNLN

ProfileScan: PS51450
IPR001611
336-358 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLDLYNNKLSGSIPEEIGYL

HMMPfam: PF12799
360-396 LRR_4,Leucine Rich repeats (2 copies)

SLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLS

ProfileScan: PS51450
IPR001611
360-383 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLGENALNGSIPASLGNLN

superfamily: SSF52047
374-684 SSF52047,LRR

SIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLH

ProfileScan: PS51450
IPR001611
384-406 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFMLYLYNNQLSGSIPEEIGYL

ProfileScan: PS51450
IPR001611
408-431 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELYLGNNSLNGSIPASLGNLN

HMMPfam: PF12799
408-444 LRR_4,Leucine Rich repeats (2 copies)

SLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLS

ProfileScan: PS51450
IPR001611
432-454 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFMLYLYNNQLSGSIPEEIGYL

HMMPfam: PF13855
455-515 LRR_8,Leucine rich repeat

SSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDL

ProfileScan: PS51450
IPR001611
456-479 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELFLGNNSLNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
480-502 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLYLYNNQLSGSIPASFGNM

ProfileScan: PS51450
IPR001611
504-526 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLFLSDNDLIGEIPSFVCNL

Gene3D: G3DSA:3.80.10.10
508-726 G3DSA:3.80.10.10

LFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRT

ProfileScan: PS51450
IPR001611
528-550 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLYMSRNNLKGKVPQCLGNI

HMMPfam: PF00560
IPR001611
528-548 LRR_1
Leucine-rich repeat

SLEVLYMSRNNLKGKVPQCLG

HMMPfam: PF13855
553-611 LRR_8,Leucine rich repeat

LHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNISSLQVFDMQNNKL

ProfileScan: PS51450
IPR001611
576-598 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILDFGRNNLEGAIPQFFGNI

HMMPfam: PF13855
624-683 LRR_8,Leucine rich repeat

SLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKL

ProfileScan: PS51450
IPR001611
624-647 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELADEIPRSLDNCK

ProfileScan: PS51450
IPR001611
648-671 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGDNQLNDTFPMWLGTLP

ProfileScan: PS51450
IPR001611
698-720 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRIIDLSRNAFSQDLPTSLFEH

HMMPfam: PF00560
IPR001611
699-721 LRR_1
Leucine-rich repeat

LRIIDLSRNAFSQDLPTSLFEHL

superfamily: SSF52058
763-877 SSF52058,LRR

TIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYPVSKGC

Gene3D: G3DSA:3.80.10.10
763-872 G3DSA:3.80.10.10

TIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRGYP

HMMPfam: PF00560
IPR001611
786-807 LRR_1
Leucine-rich repeat

IRVLNVSHNALQGYIPSSLGSL

ProfileScan: PS51450
IPR001611
809-832 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
810-845 LRR_4,Leucine Rich repeats (2 copies)

LESLDLSFNQLSGEIPQQLASLTFLEVLNLSHNYLQ

FPrintScan: PR00019
810-823 LEURICHRPT,Leucine-rich repeat signature

LESLDLSFNQLSGE

FPrintScan: PR00019
831-844 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNYL

ProfileScan: PS51450
IPR001611
833-855 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLNLSHNYLQGCIPQGPQFR


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva

List of References

M S Dixon, K Hatzixanthis, D A Jones, K Harrison, J D Jones
The tomato Cf-5 disease resistance gene and six homologs show pronounced allelic variation in leucine-rich repeat copy number.
Plant Cell: 1998, 10(11);1915-25
PubMed:9811798 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox