PRGDB00000036 (Cf-9)

From PRG Wiki
Jump to: navigation, search
Cf-9
Gene Type Reference_R-Genes,_manually_curated
GenBank 2792183 (AJ002236)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase
Chromosome 1
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Cf-9 resistance gene cluster.

DNA Sequence

ATGGATTGTGTAAAACTTGTATTCCTTATGCTATATACCTTTCTCTGTCAACTTGCTTTATCCTCATCCTTGCCTCATTTGTGCCCCGAAGATCAAGCTCTTTCTCTTCTACAATTCAAGAACATGTTTACCATTAATCCTAATGCTTCTGATTATTGTTACGACATAAGAACATACGTAGACATTCAGTCATATCCAAGAACTCTTTCTTGGAACAAAAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCCGTTGCAGCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTTTTAATAATTTCACTGGATCACTCATTTCACCAAAATTTGGTGAGTTTTCAAATTTGACGCATCTCGATTTGTCGCATTCTAGTTTTACAGGTCTAATTCCTTCTGAAATCTGTCACCTTTCTAAACTACACGTTCTTCGTATATGTGATCAATATGGGCTTAGTCTTGTACCTTACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCAACCTTGAATCTGTAAACATCTCTTCCACTATTCCTTCAAATTTCTCTTCTCATTTAACAACTCTACAACTTTCAGGCACAGAGTTACATGGGATATTGCCCGAAAGAGTTTTTCACCTTTCCAACTTACAATCCCTTCATTTATCAGTCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGACGTTATACGTCGATAGTGTGAATATTGCTGATAGGATACCTAAATCATTTAGCCATCTAACTTCACTTCATGAGTTGTACATGGGTCGTTGTAATCTGTCAGGGCCTATTCCTAAACCTCTATGGAATCTCACCAACATAGTGTTTTTGCACCTTGGTGATAACCATCTTGAAGGACCAATTTCCCATTTCACGATATTTGAAAAGCTCAAGAGGTTATCACTTGTAAATAACAACTTTGATGGCGGACTTGAGTTCTTATCCTTTAACACCCAACTTGAACGGCTAGATTTATCATCCAATTCCCTAACTGGTCCAATTCCATCCAACATAAGCGGACTTCAAAACCTAGAATGTCTCTACTTGTCATCAAACCACTTGAATGGGAGTATACCTTCCTGGATATTCTCCCTTCCTTCACTGGTTGAGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTGCCGTTACTCTAAAACAAAATAAGCTGAAAGGTCGTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAATTACTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAAAAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATTTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGGAAATTGATGAGAGTACAGGATTCCCAGAGTATATTTCTGATCCATATGATATTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTCGAATTTTGGATTCTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCTTTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGAAGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAAAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Cf-9 Cf-9 [Solanum pimpinellifolium].

MDCVKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
4-786 FAMILY NOT NAMED,FAMILY NOT NAMED

VKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPanther: PTHR24420:SF473
4-786 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPfam: PF08263
IPR013210
30-86 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
71-344 no description

WNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLV

superfamily: SSF52047
94-420 RNI-like,LRR

ALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFS

HMMSmart: SM00369
IPR003591
115-139 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLKRLDLSFNNFTGSLISPKFGE

HMMSmart: SM00365
115-145 Leucine-rich repeat, SDS22-like subfamily

LSNLKRLDLSFNNFTGSLISPKFGEFSNLTH

HMMPfam: PF00560
IPR001611
117-135 LRR_1
Leucine-rich repeat

NLKRLDLSFNNFTGSLISP

HMMSmart: SM00369
IPR003591
140-164 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FSNLTHLDLSHSSFTGLIPSEICHL

HMMPfam: PF00560
IPR001611
142-164 LRR_1
Leucine-rich repeat

NLTHLDLSHSSFTGLIPSEICHL

HMMSmart: SM00369
IPR003591
192-216 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTQLRELNLESVNISSTIPSNFSSH

Gene3D: G3DSA:3.80.10.10
345-512 no description

NNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKN

HMMSmart: SM00365
358-384 Leucine-rich repeat, SDS22-like subfamily

NTQLERLDLSSNSLTGPIPSNISGLQN

HMMPfam: PF13855
360-417 LRR_8,Leucine rich repeat

QLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNN

superfamily: SSF52058
376-774 L domain-like,LRR

PSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMSmart: SM00369
IPR003591
382-406 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQNLECLYLSSNHLNGSIPSWIFSL

Seg: seg
447-464 seg

NSLLNQKNLQLLLLSHNN

HMMSmart: SM00365
452-478 Leucine-rich repeat, SDS22-like subfamily

QKNLQLLLLSHNNISGHISSAICNLKT

HMMPfam: PF13855
503-562 LRR_8,Leucine rich repeat

YLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
504-517 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSKNRLSGT

HMMSmart: SM00365
573-598 Leucine-rich repeat, SDS22-like subfamily

LFQLKILSLRSNKLHGPIKSSGNTNL

HMMPfam: PF00560
IPR001611
602-624 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPERILGNL

Gene3D: G3DSA:3.80.10.10
672-783 no description

IINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

HMMSmart: SM00369
IPR003591
691-714 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVGLRTLNLSHNVLEGHIPASFQN

HMMPfam: PF13855
693-752 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

HMMSmart: SM00369
IPR003591
715-738 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSVLESLDLSSNKISGEIPQQLAS

HMMSmart: SM00365
715-741 Leucine-rich repeat, SDS22-like subfamily

LSVLESLDLSSNKISGEIPQQLASLTF

HMMSmart: SM00369
IPR003591
739-764 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLEVLNLSHNHLVGCIPKGKQFDS

FPrintScan: PR00019
739-752 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

Seg: seg
800-804 seg

EEEEE

Seg: seg
850-861 seg

HIITTKMKKHKK


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000035

List of References

M Parniske, K E Hammond-Kosack, C Golstein, C M Thomas, D A Jones, K Harrison, B B Wulff, J D Jones
Novel disease resistance specificities result from sequence exchange between tandemly repeated genes at the Cf-4/9 locus of tomato.
Cell: 1997, 91(6);821-32
PubMed:9413991 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox