PRGDB00000036 (Cf-9)

From PRG Wiki
Jump to: navigation, search
Cf-9
Gene Type Reference_R-Genes,_manually_curated
GenBank 2792183 (AJ002236)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase
Chromosome 1
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Cf-9 resistance gene cluster.

DNA Sequence

ATGGATTGTGTAAAACTTGTATTCCTTATGCTATATACCTTTCTCTGTCAACTTGCTTTATCCTCATCCTTGCCTCATTTGTGCCCCGAAGATCAAGCTCTTTCTCTTCTACAATTCAAGAACATGTTTACCATTAATCCTAATGCTTCTGATTATTGTTACGACATAAGAACATACGTAGACATTCAGTCATATCCAAGAACTCTTTCTTGGAACAAAAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCCGTTGCAGCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTTTTAATAATTTCACTGGATCACTCATTTCACCAAAATTTGGTGAGTTTTCAAATTTGACGCATCTCGATTTGTCGCATTCTAGTTTTACAGGTCTAATTCCTTCTGAAATCTGTCACCTTTCTAAACTACACGTTCTTCGTATATGTGATCAATATGGGCTTAGTCTTGTACCTTACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCAACCTTGAATCTGTAAACATCTCTTCCACTATTCCTTCAAATTTCTCTTCTCATTTAACAACTCTACAACTTTCAGGCACAGAGTTACATGGGATATTGCCCGAAAGAGTTTTTCACCTTTCCAACTTACAATCCCTTCATTTATCAGTCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGACGTTATACGTCGATAGTGTGAATATTGCTGATAGGATACCTAAATCATTTAGCCATCTAACTTCACTTCATGAGTTGTACATGGGTCGTTGTAATCTGTCAGGGCCTATTCCTAAACCTCTATGGAATCTCACCAACATAGTGTTTTTGCACCTTGGTGATAACCATCTTGAAGGACCAATTTCCCATTTCACGATATTTGAAAAGCTCAAGAGGTTATCACTTGTAAATAACAACTTTGATGGCGGACTTGAGTTCTTATCCTTTAACACCCAACTTGAACGGCTAGATTTATCATCCAATTCCCTAACTGGTCCAATTCCATCCAACATAAGCGGACTTCAAAACCTAGAATGTCTCTACTTGTCATCAAACCACTTGAATGGGAGTATACCTTCCTGGATATTCTCCCTTCCTTCACTGGTTGAGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTGCCGTTACTCTAAAACAAAATAAGCTGAAAGGTCGTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAATTACTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAAAAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATTTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGGAAATTGATGAGAGTACAGGATTCCCAGAGTATATTTCTGATCCATATGATATTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTCGAATTTTGGATTCTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCTTTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGAAGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAAAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Cf-9 Cf-9 [Solanum pimpinellifolium].

MDCVKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
4-786 FAMILY NOT NAMED,FAMILY NOT NAMED

VKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPanther: PTHR24420:SF473
4-786 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPfam: PF08263
IPR013210
30-86 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
71-344 no description

WNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLV

superfamily: SSF52047
94-420 RNI-like,LRR

ALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFS

HMMSmart: SM00369
IPR003591
115-139 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLKRLDLSFNNFTGSLISPKFGE

HMMSmart: SM00365
115-145 Leucine-rich repeat, SDS22-like subfamily

LSNLKRLDLSFNNFTGSLISPKFGEFSNLTH

HMMPfam: PF00560
IPR001611
117-135 LRR_1
Leucine-rich repeat

NLKRLDLSFNNFTGSLISP

HMMSmart: SM00369
IPR003591
140-164 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FSNLTHLDLSHSSFTGLIPSEICHL

HMMPfam: PF00560
IPR001611
142-164 LRR_1
Leucine-rich repeat

NLTHLDLSHSSFTGLIPSEICHL

HMMSmart: SM00369
IPR003591
192-216 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTQLRELNLESVNISSTIPSNFSSH

Gene3D: G3DSA:3.80.10.10
345-512 no description

NNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKN

HMMSmart: SM00365
358-384 Leucine-rich repeat, SDS22-like subfamily

NTQLERLDLSSNSLTGPIPSNISGLQN

HMMPfam: PF13855
360-417 LRR_8,Leucine rich repeat

QLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNN

superfamily: SSF52058
376-774 L domain-like,LRR

PSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMSmart: SM00369
IPR003591
382-406 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQNLECLYLSSNHLNGSIPSWIFSL

Seg: seg
447-464 seg

NSLLNQKNLQLLLLSHNN

HMMSmart: SM00365
452-478 Leucine-rich repeat, SDS22-like subfamily

QKNLQLLLLSHNNISGHISSAICNLKT

HMMPfam: PF13855
503-562 LRR_8,Leucine rich repeat

YLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
504-517 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSKNRLSGT

HMMSmart: SM00365
573-598 Leucine-rich repeat, SDS22-like subfamily

LFQLKILSLRSNKLHGPIKSSGNTNL

HMMPfam: PF00560
IPR001611
602-624 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPERILGNL

Gene3D: G3DSA:3.80.10.10
672-783 no description

IINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

HMMSmart: SM00369
IPR003591
691-714 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVGLRTLNLSHNVLEGHIPASFQN

HMMPfam: PF13855
693-752 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

HMMSmart: SM00369
IPR003591
715-738 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSVLESLDLSSNKISGEIPQQLAS

HMMSmart: SM00365
715-741 Leucine-rich repeat, SDS22-like subfamily

LSVLESLDLSSNKISGEIPQQLASLTF

HMMSmart: SM00369
IPR003591
739-764 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLEVLNLSHNHLVGCIPKGKQFDS

FPrintScan: PR00019
739-752 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

Seg: seg
800-804 seg

EEEEE

Seg: seg
850-861 seg

HIITTKMKKHKK


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000035

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox