PRGDB00000037 (Cf9B)

From PRG Wiki
Jump to: navigation, search
Cf9B
Gene Type Reference_R-Genes,_manually_curated
GenBank 2792183 (AJ002236)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 1
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Cf-9 resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACTTGTTTACCGTTAATCCTAATGCTTTTCATTATTGTCCTGACATAACAGGCCGAGAGATTCAGTCATATCCAAGAACTCTTTCTTGGAACAAGAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCCGTTGCAGCCAACTTCAAGGCAAGTTTCATTCAAACAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATCTGTCGAATAATAACTTCATTGGATCGCTCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGGATTCTAGTTTTACGGGTGTAATCCCTTCTGAAATCTCTCATCTTTCTAAACTACACGTTCTTCGTATTATTGATCTAAATGAGCTTAGTCTTGGGCCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAAAGCTCAACCTTGACTCAGTCAACATCTCTTCCACTATTCCTTCCAATTTCTCCTCTCATTTAACAACTCTACAACTTTCAGGCACAGAGTTACATGGGATATTGCCTGAAAGAGTTTTCCACCTTTCCGACTTAGAATTCCTTTATTTATCAGGCAATCCCAAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATACGTCGATAGTGTGAATATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATGAGTTGGACATGGGTTATACTAATCTATCAGGGCCTATTCCTAAACCTTTATGGAATCTCACCAACATAGAGAGTTTGTTCCTTGATGAGAACCATCTTGAAGGACCAATTCCCCAGCTCCCGAGATTTGAAAAGCTCAACGACTTATCACTTGGATATAACAACTTGGATGGAGGACTTGAGTTCTTATCCTCTAACAGAAGCTGGACGCAGCTTAAAGGATTAGATTTTTCGTCCAATTACCTTACTGGTCCAATTCCATCCAACGTAAGTGGACTACGAAATCTACAATCACTCCACTTGTCATCAAACCACTTGAATGGGAGTATACCTTTCTGGATATTCTCCCTTCCTTCACTGATAGTGTTAGACTTGAGCAATAATACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTACCGTTACTCTAAAACAAAATAAGCTGAAAGGTCGTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAACTCCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATCTCATTTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGTATTTTGGGGAATTTGCAAGCAATGAAAAAAATTGATGAGAGTACAAGAACACCAGAGTATATTTCTGATCCATATGATTTTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTAGAATTTTTAATTCTAACATGATTATCAATCTCTCAAAGAACAGATTCGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTATCTCACAATGCCTTGGAAGGTCATATACCGGCATCATTGCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATACGTTCTTGAACAGTTCATACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGATGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGACGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCATGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATTGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Hcr9-9B Hcr9-9B [Solanum pimpinellifolium].

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSKLCGGDDQVTTPAELDQEDEEEDSPMISWQGVLMGYGCGLVIGLSVIYIMWSTQYPALFSRMDLKLEHIITTRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-795 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSKLCGGDDQVTT

HMMPanther: PTHR24420
1-795 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSKLCGGDDQVTT

HMMPfam: PF08263
IPR013210
30-85 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
67-343 G3DSA:3.80.10.10

TLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLG

superfamily: SSF52047
93-422 SSF52047,LRR

ALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFS

HMMPfam: PF13516
114-130 LRR_6,Leucine Rich repeat

LSNLKRLDLSNNNFIGS

HMMPfam: PF00560
IPR001611
142-163 LRR_1
Leucine-rich repeat

LTHLDLSDSSFTGVIPSEISHL

HMMPfam: PF00560
IPR001611
240-287 LRR_1
Leucine-rich repeat

LEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHL

Gene3D: G3DSA:3.80.10.10
344-514 G3DSA:3.80.10.10

YNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNN

superfamily: SSF52058
358-776 SSF52058,LRR

RSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGND

HMMPfam: PF00560
IPR001611
386-407 LRR_1
Leucine-rich repeat

NLQSLHLSSNHLNGSIPFWIFS

HMMPfam: PF00560
IPR001611
410-429 LRR_1
Leucine-rich repeat

SLIVLDLSNNTFSGKIQEFK

HMMPfam: PF13855
505-564 LRR_8,Leucine rich repeat

YLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
506-519 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNRLSGT

Gene3D: G3DSA:3.80.10.10
515-631 G3DSA:3.80.10.10

RLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKK

HMMPfam: PF00560
IPR001611
604-626 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPESILGNL

Gene3D: G3DSA:3.80.10.10
675-785 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSK

HMMPfam: PF13855
695-754 LRR_8,Leucine rich repeat

GLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

FPrintScan: PR00019
741-754 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox