PRGDB00000037 (Cf9B)

From PRG Wiki
Jump to: navigation, search
Cf9B
Gene Type Reference_R-Genes,_manually_curated
GenBank 2792183 (AJ002236)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 1
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Cf-9 resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACTTGTTTACCGTTAATCCTAATGCTTTTCATTATTGTCCTGACATAACAGGCCGAGAGATTCAGTCATATCCAAGAACTCTTTCTTGGAACAAGAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCCGTTGCAGCCAACTTCAAGGCAAGTTTCATTCAAACAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATCTGTCGAATAATAACTTCATTGGATCGCTCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGGATTCTAGTTTTACGGGTGTAATCCCTTCTGAAATCTCTCATCTTTCTAAACTACACGTTCTTCGTATTATTGATCTAAATGAGCTTAGTCTTGGGCCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAAAGCTCAACCTTGACTCAGTCAACATCTCTTCCACTATTCCTTCCAATTTCTCCTCTCATTTAACAACTCTACAACTTTCAGGCACAGAGTTACATGGGATATTGCCTGAAAGAGTTTTCCACCTTTCCGACTTAGAATTCCTTTATTTATCAGGCAATCCCAAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATACGTCGATAGTGTGAATATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATGAGTTGGACATGGGTTATACTAATCTATCAGGGCCTATTCCTAAACCTTTATGGAATCTCACCAACATAGAGAGTTTGTTCCTTGATGAGAACCATCTTGAAGGACCAATTCCCCAGCTCCCGAGATTTGAAAAGCTCAACGACTTATCACTTGGATATAACAACTTGGATGGAGGACTTGAGTTCTTATCCTCTAACAGAAGCTGGACGCAGCTTAAAGGATTAGATTTTTCGTCCAATTACCTTACTGGTCCAATTCCATCCAACGTAAGTGGACTACGAAATCTACAATCACTCCACTTGTCATCAAACCACTTGAATGGGAGTATACCTTTCTGGATATTCTCCCTTCCTTCACTGATAGTGTTAGACTTGAGCAATAATACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTACCGTTACTCTAAAACAAAATAAGCTGAAAGGTCGTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAACTCCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATCTCATTTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGTATTTTGGGGAATTTGCAAGCAATGAAAAAAATTGATGAGAGTACAAGAACACCAGAGTATATTTCTGATCCATATGATTTTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTAGAATTTTTAATTCTAACATGATTATCAATCTCTCAAAGAACAGATTCGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTATCTCACAATGCCTTGGAAGGTCATATACCGGCATCATTGCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATACGTTCTTGAACAGTTCATACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGATGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGACGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCATGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATTGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Hcr9-9B Hcr9-9B [Solanum pimpinellifolium].

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSKLCGGDDQVTTPAELDQEDEEEDSPMISWQGVLMGYGCGLVIGLSVIYIMWSTQYPALFSRMDLKLEHIITTRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-795 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSKLCGGDDQVTT

HMMPanther: PTHR24420
1-795 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSKLCGGDDQVTT

HMMPfam: PF08263
IPR013210
30-85 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNLFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
67-343 G3DSA:3.80.10.10

TLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLG

superfamily: SSF52047
93-422 SSF52047,LRR

ALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLRIIDLNELSLGPHNFELLLKNLTQLRKLNLDSVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSDLEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDENHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFS

HMMPfam: PF13516
114-130 LRR_6,Leucine Rich repeat

LSNLKRLDLSNNNFIGS

HMMPfam: PF00560
IPR001611
142-163 LRR_1
Leucine-rich repeat

LTHLDLSDSSFTGVIPSEISHL

HMMPfam: PF00560
IPR001611
240-287 LRR_1
Leucine-rich repeat

LEFLYLSGNPKLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHL

Gene3D: G3DSA:3.80.10.10
344-514 G3DSA:3.80.10.10

YNNLDGGLEFLSSNRSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNN

superfamily: SSF52058
358-776 SSF52058,LRR

RSWTQLKGLDFSSNYLTGPIPSNVSGLRNLQSLHLSSNHLNGSIPFWIFSLPSLIVLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDPYDFYYNYLTTISTKGQDYDSVRIFNSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGND

HMMPfam: PF00560
IPR001611
386-407 LRR_1
Leucine-rich repeat

NLQSLHLSSNHLNGSIPFWIFS

HMMPfam: PF00560
IPR001611
410-429 LRR_1
Leucine-rich repeat

SLIVLDLSNNTFSGKIQEFK

HMMPfam: PF13855
505-564 LRR_8,Leucine rich repeat

YLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
506-519 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNRLSGT

Gene3D: G3DSA:3.80.10.10
515-631 G3DSA:3.80.10.10

RLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLSHLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPESILGNLQAMKK

HMMPfam: PF00560
IPR001611
604-626 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPESILGNL

Gene3D: G3DSA:3.80.10.10
675-785 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDTFLNSSYQGNDGLRGFPLSK

HMMPfam: PF13855
695-754 LRR_8,Leucine rich repeat

GLRTLNLSHNALEGHIPASLQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

FPrintScan: PR00019
741-754 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva

List of References

M Parniske, K E Hammond-Kosack, C Golstein, C M Thomas, D A Jones, K Harrison, B B Wulff, J D Jones
Novel disease resistance specificities result from sequence exchange between tandemly repeated genes at the Cf-4/9 locus of tomato.
Cell: 1997, 91(6);821-32
PubMed:9413991 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox