PRGDB00000039 (Gro1.4)

From PRG Wiki
Jump to: navigation, search
Gro1.4
Gene Type Reference_R-Genes,_manually_curated
GenBank 37781225 (AY196151)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Chromosome 7
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum nematode resistance protein (Gro1-4) gene, Gro1-4-P40 allele, complete cds.

DNA Sequence

ATGAATCAGGAAAGTTCATTGCTTCCATCCCCAGATATTATTCGATGGAGTTACGATGTTTTCTTAAGTTTTAGAGGTGAAGATGTACGCAAAACATTTGTTGACCATCTGTACCTTGCTCTGGAACAAAAGTGCATTAATACCTTTAAAGATGACGAGAAACTAGAGAAAGGAAAGTTCATTTCACCGGAACTCGTGAGTTCAATTGAAGAGTCAAGGATAGCTTTGATCATTTTCTCTAAAAACTATGCTAATTCAACATGGTGTTTAGATGAATTGACAAAGATCATGGAGTGCAAGAATGTGAAAGGACAAATTGTTGTTCCGGTGTTCTATGATGTAGATCCATCAACAGTGAGGAAACAAAAATCCATATTTGGAGAAGCATTTAGCAAACATGAAGCCCGGTTCCAGGAGGACAAGGTGCAAAAATGGAGGGCAGCACTGGAGGAAGCAGCTAATATTTCTGGCTGGGATTTGCCAAATACTGCCAATGGACATGAAGCTAGAGTCATGGAGAAAATTGCAGAAGATATAATGGCTAGATTGGGTAGTCAGAGACATGCAAGCAATGCTAGAAATCTTGTTGGAATGGAGTCACACATGCACAAGGTATATAAAATGCTTGGAATCGGGTCTGGTGGAGTTCACTTCCTTGGAATATTGGGAATGAGCGGAGTGGGGAAGACAACTCTAGCGAGAGTTATTTATGATAACATTCGGAGTCAATTTCAAGGTGCATGTTTTCTTCACGAAGTCAGAGACCGTTCAGCAAAACAGGGACTAGAGCGCTTGCAAGAGATACTTCTTTCTGAGATCCTTGTTGTAAAAAAACTAAGGATCAACGATTCATTTGAAGGAGCTAATATGCAAAAACAAAGACTACAGTACAAAAAGGTTCTTCTTGTTCTGGATGATGTTGATCACATAGATCAGTTAAATGCATTAGCCGGGGAGCGTGAATGGTTTGGTGACGGAAGTAGAATCATCATAACAACCAAAGATAAACACTTGCTTGTTAAGTATGAGACTGAAAAGATATACAGAATGAAAACTTTAAACAATTATGAAAGTTTACAACTTTTTAAACAACATGCTTTCAAGAAAAACCGCCCTACCAAAGAATTCGAGGATCTATCAGCTCAAGTGATAAAGCATACCGATGGACTCCCCCTAGCTCTGAAAGTCCTGGGAAGTTTCTTGTATGGAAGAGGTTTGGATGAATGGATAAGTGAAGTGGAGCGTTTGAAACAAATCCCAGAAAATGAAATTTTGAAGAAACTCGAACAAAGTTTCACTGGTCTCCACAATACTGAGCAAAAGATATTCTTAGACATTGCATGTTTCTTTTCAGGGAAGAAGAAAGATTCAGTGACCAGAATACTTGAGAGTTTTCATTTTTGCCCTGTCATTGGGATAAAAGTTCTCATGGAGAAATGTTTGATCACTATATTACAAGGTCGCATTACAATACACCAATTGATCCAAGATATGGGCTGGCACATTGTTCGTCGAGAAGCTACTGACGATCCAAGAATGTGTAGTAGGATGTGGAAGCGCGAAGATATTTGTCCTGTACTTGAAAGAAATTTGGGCACTGACAAGAACGAAGGCATGTCGCTGCACCTGACTAATGAAGAAGAAGTTAATTTTGGTGGCAAGGCCTTCATGCAGATGACCAGACTAAGGTTTCTCAAATTCCGGAATGCATATGTTTGCCAGGGACCTGAATTTCTTCCAGATGAGTTGAGGTGGCTTGATTGGCATGGATATCCTTCAAAAAGTCTGCCAAATAGTTTTAAGGGAGACCAACTTGTTGGTTTGAAATTGAAAAAAAGCCGCATCATACAACTTTGGAAAACCTCAAAGGATCTAGGAAAACTGAAGTACATGAACCTTAGCCATTCACAGAAGCTAATAAGGACGCCAGATTTTTCAGTTACGCCTAACCTTGAAAGACTGGTTCTTGAAGAATGCACTAGTTTGGTAGAAATCAATTTTTCTATTGAAAATCTTGGAAAGCTAGTCTTGCTGAATCTGAAGAACTGCAGAAATTTAAAGACCCTACCGAAGAGAATTCGATTGGAAAAGCTTGAAATTCTCGTTCTTACAGGCTGCTCAAAGTTAAGAACATTCCCAGAAATAGAAGAGAAAATGAATTGTTTAGCAGAACTGTATTTGGGTGCGACTTCTTTGAGTGAACTACCTGCATCAGTTGAGAACCTTTCAGGAGTTGGTGTAATAAATCTAAGTTACTGCAAGCATCTTGAGAGTCTACCTAGCAGTATTTTTAGGTTGAAATGTTTGAAAACACTTGATGTGTCCGGATGCTCAAAACTTAAAAATTTACCAGATGATTTGGGACTTTTGGTTGGTTTAGAGGAGCTCCACTGCACTCACACAGCCATCCAAACAATTCCTTCTTCTATGTCTCTTCTTAAAAACCTTAAGCACTTATCTCTCAGTGGATGTAATGCTTTGAGTTCACAAGTAAGCAGCTCAAGTCATGGCCAGAAGTCTATGGGTGTAAATTTTCAGAATTTGTCAGGTCTTTGTTCATTGATCATGTTGGATCTTAGTGACTGCAACATTTCAGATGGAGGCATTTTAAATAATCTTGGGTTCTTATCGTCTTTGGAGATACTGATTCTCAATGGTAACAATTTTTCCAATATTCCGGCTGCAAGCATAAGTCGTTTCACTCGACTTAAACGCCTTAAATTGCATGGTTGTGGGAGGCTTGAGAGTTTACCGGAACTTCCTCCGAGTATAAAAGGGATATTTGCTAATGAATGCACATCTTTGATGAGTATTGATCAACTAACCAAATATCCAATGTTGAGTGATGCTACATTCAGAAACTGTCGTCAACTCGTAAAAAATAAACAGCACACCTCCATGGTTGATTCATTGTTGAAGCAGATGCTCGAGGCACTATATATGAATGTCAGATTTTGCTTGTACGTCCCTGGTATGGAGATTCCCGAGTGGTTTACATACAAGAGCTGGGGGACTCAATCAATGTCAGTGGCCCTCCCCACAAATTGGTTCACACCCACATTCAGGGGGTTTACTGTTTGTGTTATTTTAGACAAGAAGATGCTTTTCATTTTAGGTCGCTTCAATACTCATAAAGTCTATGGCCTAGAAAATATGATATGGTTAAATCTCAAAAGATATGACGGTTTGCGGCAAAAAATTAGCACATCTTTCGGCCCAATAGGAAGTGAAAAACCTGGTGGTTTAGGTGATACTTTAATAACCCATATAGCATTTGAAAGATCTTGGAAGTTGGAGAATGATCTCGATTACTATCGTAATAACGCCTTTCAGCTTGAATTTAGTGCCTGTGATCATTATCAAAAGGATGTGGTAAAAGGTTTGGGAGTGCGTCTTGTGTATGAGAATTGA


Protein sequences

Name Description Sequence
nematode resistance protein nematode resistance protein [Solanum tuberosum].

MNQESSLLPSPDIIRWSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNKQHTSMVDSLLKQMLEALYMNVRFCLYVPGMEIPEWFTYKSWGTQSMSVALPTNWFTPTFRGFTVCVILDKKMLFILGRFNTHKVYGLENMIWLNLKRYDGLRQKISTSFGPIGSEKPGGLGDTLITHIAFERSWKLENDLDYYRNNAFQLEFSACDHYQKDVVKGLGVRLVYEN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLLPSPDIIRWSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGW

Gene3D: G3DSA:3.40.50.10140
16-150 G3DSA:3.40.50.10140

WSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALE

ProfileScan: PS50104
IPR000157
16-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANI

HMMSmart: SM00255
IPR000157
17-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANI

HMMPfam: PF01582
IPR000157
20-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALE

HMMPanther: PTHR11017
44-1009 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNKQHTSMVDSLLKQMLEALYMNVRFCLYVPGMEIPEWFTYKSWGTQSMS

HMMPanther: PTHR11017:SF20
44-1009 PTHR11017:SF20,SUBFAMILY NOT NAMED

KCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNKQHTSMVDSLLKQMLEALYMNVRFCLYVPGMEIPEWFTYKSWGTQSMS

superfamily: SSF52540
178-424 SSF52540

DIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEI

Gene3D: G3DSA:3.40.50.300
187-342 G3DSA:3.40.50.300

RHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKY

HMMPfam: PF00931
IPR002182
199-456 NB-ARC,NBS
NB-ARC

ESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKD

FPrintScan: PR00364
IPR000767
218-233 DISEASERSIST
Disease resistance protein

FLGILGMSGVGKTTLA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

RLQYKKVLLVLDDVD

FPrintScan: PR00364
IPR000767
387-401 DISEASERSIST
Disease resistance protein

TDGLPLALKVLGSFL

superfamily: SSF46785
422-528 SSF46785

NEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLE

superfamily: SSF52058
490-962 SSF52058,LRR

TIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNK

Gene3D: G3DSA:3.80.10.10
541-846 G3DSA:3.80.10.10

LHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQ

FPrintScan: PR00364
IPR000767
764-780 DISEASERSIST
Disease resistance protein

FRLKCLKTLDVSGCSKL

HMMPfam: PF00560
IPR001611
769-788 LRR_1
Leucine-rich repeat

LKTLDVSGCSKLKNLPDDLG

Gene3D: G3DSA:3.80.10.10
847-921 G3DSA:3.80.10.10

NLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELP

HMMPfam: PF00560
IPR001611
878-897 LRR_1
Leucine-rich repeat

SLEILILNGNNFSNIPAASI


Diseases

Disease Pathogen Avirulence gene
Late Blight Potato Phytophthora infestans

List of References

Jürgen Paal, Heike Henselewski, Jost Muth, Khalid Meksem, Cristina M Menéndez, Francesco Salamini, Agim Ballvora, Christiane Gebhardt
Molecular cloning of the potato Gro1-4 gene conferring resistance to pathotype Ro1 of the root cyst nematode Globodera rostochiensis, based on a candidate gene approach.
Plant J.: 2004, 38(2);285-97
PubMed:15078331 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox