PRGDB00000039 (Gro1.4)

From PRG Wiki
Jump to: navigation, search
Gro1.4
Gene Type Reference_R-Genes,_manually_curated
GenBank 37781225 (AY196151)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Chromosome 7
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum nematode resistance protein (Gro1-4) gene, Gro1-4-P40 allele, complete cds.

DNA Sequence

ATGAATCAGGAAAGTTCATTGCTTCCATCCCCAGATATTATTCGATGGAGTTACGATGTTTTCTTAAGTTTTAGAGGTGAAGATGTACGCAAAACATTTGTTGACCATCTGTACCTTGCTCTGGAACAAAAGTGCATTAATACCTTTAAAGATGACGAGAAACTAGAGAAAGGAAAGTTCATTTCACCGGAACTCGTGAGTTCAATTGAAGAGTCAAGGATAGCTTTGATCATTTTCTCTAAAAACTATGCTAATTCAACATGGTGTTTAGATGAATTGACAAAGATCATGGAGTGCAAGAATGTGAAAGGACAAATTGTTGTTCCGGTGTTCTATGATGTAGATCCATCAACAGTGAGGAAACAAAAATCCATATTTGGAGAAGCATTTAGCAAACATGAAGCCCGGTTCCAGGAGGACAAGGTGCAAAAATGGAGGGCAGCACTGGAGGAAGCAGCTAATATTTCTGGCTGGGATTTGCCAAATACTGCCAATGGACATGAAGCTAGAGTCATGGAGAAAATTGCAGAAGATATAATGGCTAGATTGGGTAGTCAGAGACATGCAAGCAATGCTAGAAATCTTGTTGGAATGGAGTCACACATGCACAAGGTATATAAAATGCTTGGAATCGGGTCTGGTGGAGTTCACTTCCTTGGAATATTGGGAATGAGCGGAGTGGGGAAGACAACTCTAGCGAGAGTTATTTATGATAACATTCGGAGTCAATTTCAAGGTGCATGTTTTCTTCACGAAGTCAGAGACCGTTCAGCAAAACAGGGACTAGAGCGCTTGCAAGAGATACTTCTTTCTGAGATCCTTGTTGTAAAAAAACTAAGGATCAACGATTCATTTGAAGGAGCTAATATGCAAAAACAAAGACTACAGTACAAAAAGGTTCTTCTTGTTCTGGATGATGTTGATCACATAGATCAGTTAAATGCATTAGCCGGGGAGCGTGAATGGTTTGGTGACGGAAGTAGAATCATCATAACAACCAAAGATAAACACTTGCTTGTTAAGTATGAGACTGAAAAGATATACAGAATGAAAACTTTAAACAATTATGAAAGTTTACAACTTTTTAAACAACATGCTTTCAAGAAAAACCGCCCTACCAAAGAATTCGAGGATCTATCAGCTCAAGTGATAAAGCATACCGATGGACTCCCCCTAGCTCTGAAAGTCCTGGGAAGTTTCTTGTATGGAAGAGGTTTGGATGAATGGATAAGTGAAGTGGAGCGTTTGAAACAAATCCCAGAAAATGAAATTTTGAAGAAACTCGAACAAAGTTTCACTGGTCTCCACAATACTGAGCAAAAGATATTCTTAGACATTGCATGTTTCTTTTCAGGGAAGAAGAAAGATTCAGTGACCAGAATACTTGAGAGTTTTCATTTTTGCCCTGTCATTGGGATAAAAGTTCTCATGGAGAAATGTTTGATCACTATATTACAAGGTCGCATTACAATACACCAATTGATCCAAGATATGGGCTGGCACATTGTTCGTCGAGAAGCTACTGACGATCCAAGAATGTGTAGTAGGATGTGGAAGCGCGAAGATATTTGTCCTGTACTTGAAAGAAATTTGGGCACTGACAAGAACGAAGGCATGTCGCTGCACCTGACTAATGAAGAAGAAGTTAATTTTGGTGGCAAGGCCTTCATGCAGATGACCAGACTAAGGTTTCTCAAATTCCGGAATGCATATGTTTGCCAGGGACCTGAATTTCTTCCAGATGAGTTGAGGTGGCTTGATTGGCATGGATATCCTTCAAAAAGTCTGCCAAATAGTTTTAAGGGAGACCAACTTGTTGGTTTGAAATTGAAAAAAAGCCGCATCATACAACTTTGGAAAACCTCAAAGGATCTAGGAAAACTGAAGTACATGAACCTTAGCCATTCACAGAAGCTAATAAGGACGCCAGATTTTTCAGTTACGCCTAACCTTGAAAGACTGGTTCTTGAAGAATGCACTAGTTTGGTAGAAATCAATTTTTCTATTGAAAATCTTGGAAAGCTAGTCTTGCTGAATCTGAAGAACTGCAGAAATTTAAAGACCCTACCGAAGAGAATTCGATTGGAAAAGCTTGAAATTCTCGTTCTTACAGGCTGCTCAAAGTTAAGAACATTCCCAGAAATAGAAGAGAAAATGAATTGTTTAGCAGAACTGTATTTGGGTGCGACTTCTTTGAGTGAACTACCTGCATCAGTTGAGAACCTTTCAGGAGTTGGTGTAATAAATCTAAGTTACTGCAAGCATCTTGAGAGTCTACCTAGCAGTATTTTTAGGTTGAAATGTTTGAAAACACTTGATGTGTCCGGATGCTCAAAACTTAAAAATTTACCAGATGATTTGGGACTTTTGGTTGGTTTAGAGGAGCTCCACTGCACTCACACAGCCATCCAAACAATTCCTTCTTCTATGTCTCTTCTTAAAAACCTTAAGCACTTATCTCTCAGTGGATGTAATGCTTTGAGTTCACAAGTAAGCAGCTCAAGTCATGGCCAGAAGTCTATGGGTGTAAATTTTCAGAATTTGTCAGGTCTTTGTTCATTGATCATGTTGGATCTTAGTGACTGCAACATTTCAGATGGAGGCATTTTAAATAATCTTGGGTTCTTATCGTCTTTGGAGATACTGATTCTCAATGGTAACAATTTTTCCAATATTCCGGCTGCAAGCATAAGTCGTTTCACTCGACTTAAACGCCTTAAATTGCATGGTTGTGGGAGGCTTGAGAGTTTACCGGAACTTCCTCCGAGTATAAAAGGGATATTTGCTAATGAATGCACATCTTTGATGAGTATTGATCAACTAACCAAATATCCAATGTTGAGTGATGCTACATTCAGAAACTGTCGTCAACTCGTAAAAAATAAACAGCACACCTCCATGGTTGATTCATTGTTGAAGCAGATGCTCGAGGCACTATATATGAATGTCAGATTTTGCTTGTACGTCCCTGGTATGGAGATTCCCGAGTGGTTTACATACAAGAGCTGGGGGACTCAATCAATGTCAGTGGCCCTCCCCACAAATTGGTTCACACCCACATTCAGGGGGTTTACTGTTTGTGTTATTTTAGACAAGAAGATGCTTTTCATTTTAGGTCGCTTCAATACTCATAAAGTCTATGGCCTAGAAAATATGATATGGTTAAATCTCAAAAGATATGACGGTTTGCGGCAAAAAATTAGCACATCTTTCGGCCCAATAGGAAGTGAAAAACCTGGTGGTTTAGGTGATACTTTAATAACCCATATAGCATTTGAAAGATCTTGGAAGTTGGAGAATGATCTCGATTACTATCGTAATAACGCCTTTCAGCTTGAATTTAGTGCCTGTGATCATTATCAAAAGGATGTGGTAAAAGGTTTGGGAGTGCGTCTTGTGTATGAGAATTGA


Protein sequences

Name Description Sequence
nematode resistance protein nematode resistance protein [Solanum tuberosum].

MNQESSLLPSPDIIRWSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNKQHTSMVDSLLKQMLEALYMNVRFCLYVPGMEIPEWFTYKSWGTQSMSVALPTNWFTPTFRGFTVCVILDKKMLFILGRFNTHKVYGLENMIWLNLKRYDGLRQKISTSFGPIGSEKPGGLGDTLITHIAFERSWKLENDLDYYRNNAFQLEFSACDHYQKDVVKGLGVRLVYEN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLLPSPDIIRWSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGW

Gene3D: G3DSA:3.40.50.10140
16-150 G3DSA:3.40.50.10140

WSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALE

ProfileScan: PS50104
IPR000157
16-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANI

HMMSmart: SM00255
IPR000157
17-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANI

HMMPfam: PF01582
IPR000157
20-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALE

HMMPanther: PTHR11017
44-1009 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNKQHTSMVDSLLKQMLEALYMNVRFCLYVPGMEIPEWFTYKSWGTQSMS

HMMPanther: PTHR11017:SF20
44-1009 PTHR11017:SF20,SUBFAMILY NOT NAMED

KCINTFKDDEKLEKGKFISPELVSSIEESRIALIIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEARFQEDKVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNKQHTSMVDSLLKQMLEALYMNVRFCLYVPGMEIPEWFTYKSWGTQSMS

superfamily: SSF52540
178-424 SSF52540

DIMARLGSQRHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEI

Gene3D: G3DSA:3.40.50.300
187-342 G3DSA:3.40.50.300

RHASNARNLVGMESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKY

HMMPfam: PF00931
IPR002182
199-456 NB-ARC,NBS
NB-ARC

ESHMHKVYKMLGIGSGGVHFLGILGMSGVGKTTLARVIYDNIRSQFQGACFLHEVRDRSAKQGLERLQEILLSEILVVKKLRINDSFEGANMQKQRLQYKKVLLVLDDVDHIDQLNALAGEREWFGDGSRIIITTKDKHLLVKYETEKIYRMKTLNNYESLQLFKQHAFKKNRPTKEFEDLSAQVIKHTDGLPLALKVLGSFLYGRGLDEWISEVERLKQIPENEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKD

FPrintScan: PR00364
IPR000767
218-233 DISEASERSIST
Disease resistance protein

FLGILGMSGVGKTTLA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

RLQYKKVLLVLDDVD

FPrintScan: PR00364
IPR000767
387-401 DISEASERSIST
Disease resistance protein

TDGLPLALKVLGSFL

superfamily: SSF46785
422-528 SSF46785

NEILKKLEQSFTGLHNTEQKIFLDIACFFSGKKKDSVTRILESFHFCPVIGIKVLMEKCLITILQGRITIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLE

superfamily: SSF52058
490-962 SSF52058,LRR

TIHQLIQDMGWHIVRREATDDPRMCSRMWKREDICPVLERNLGTDKNEGMSLHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQNLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELPPSIKGIFANECTSLMSIDQLTKYPMLSDATFRNCRQLVKNK

Gene3D: G3DSA:3.80.10.10
541-846 G3DSA:3.80.10.10

LHLTNEEEVNFGGKAFMQMTRLRFLKFRNAYVCQGPEFLPDELRWLDWHGYPSKSLPNSFKGDQLVGLKLKKSRIIQLWKTSKDLGKLKYMNLSHSQKLIRTPDFSVTPNLERLVLEECTSLVEINFSIENLGKLVLLNLKNCRNLKTLPKRIRLEKLEILVLTGCSKLRTFPEIEEKMNCLAELYLGATSLSELPASVENLSGVGVINLSYCKHLESLPSSIFRLKCLKTLDVSGCSKLKNLPDDLGLLVGLEELHCTHTAIQTIPSSMSLLKNLKHLSLSGCNALSSQVSSSSHGQKSMGVNFQ

FPrintScan: PR00364
IPR000767
764-780 DISEASERSIST
Disease resistance protein

FRLKCLKTLDVSGCSKL

HMMPfam: PF00560
IPR001611
769-788 LRR_1
Leucine-rich repeat

LKTLDVSGCSKLKNLPDDLG

Gene3D: G3DSA:3.80.10.10
847-921 G3DSA:3.80.10.10

NLSGLCSLIMLDLSDCNISDGGILNNLGFLSSLEILILNGNNFSNIPAASISRFTRLKRLKLHGCGRLESLPELP

HMMPfam: PF00560
IPR001611
878-897 LRR_1
Leucine-rich repeat

SLEILILNGNNFSNIPAASI


Diseases

Disease Pathogen Avirulence gene
Late Blight Potato Phytophthora infestans

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox