PRGDB00000040 (Hero)

From PRG Wiki
Jump to: navigation, search
Hero
Gene Type Reference_R-Genes,_manually_curated
GenBank 23095860 (AJ457052)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 4
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum hero gene for hero resistance protein, exons 2-3.

DNA Sequence

ATGGAAAAAGGAGAAAAACCATTGCTACTATTTGAGGAACAAAAAAAAAGAATCACGAATCTTATTGATGATTTCTTGAATGGTTTGAAGCAAATAATGAACGAAGAAGAAGAATTCATTGCTTCAAAATTGGATGTGATTCAAAAGCTAAGAATGGATCTAAGATTACTTAGAACATTTGTCTTGTTTGGGAATTCGACGAATTTGGATGACTTTTATTACAGGATGAATATTCATATAAACAAATTCAATATACTTACTGAGACCCTTTTCTGTAAAGATGATTTAATCCTAGAGAAATACCACATGGAATGTGTTGCCCCTCTGCTGCTGAAAGAGATAAGAAATTATTTGAGTTTGAAGAATGATTATGTAGCCACGGCGATAGAGATGAAGAAGTTTGAATACCTCATCAGAAATCTCCATGATCTACCAAAGTATTGTTATGATTTGCTTCAACCCCTCATGAGTGAATACAAGATTCTTCGGCAAGTATGCACACATCTCAGAGATTTCTATCAGTTGGAATGCAACAAAACAACAAAAACAGAATTTCTCTATACTCGGTATCAAGTGACAGTTGATAGAGTAACACAATTCTGTTTTGATCTTTGGACTGGAAAGTACAGAAACTATAGATACGAGTATGCCTTCTCTAAATGCTCTTCCAAGATCACTTCTCTACTCATCGACATAATCCCTCTTGAGCTGGAGGTTCTACACATTTCTACTTCTAACCTCATCAAAGAATCAAGGTCAAAAGAACTAGAAGGATTTGTTAAGCAAATCCTAAAAGCATCTCCAAGGATTCTTCAAAAGCATCTCATTCATCTCCAAGGACGCATGGTAGCCGACAGTTACTCTGCAACTCAAAGCATTAATGTCATGATGGAGTTCCTGTTGATCTTTCTCACTGATATACCAAAGCGCTTTATCCATCGTGGCAAATTGAACTCTATGTTGGCACATGTCGGACTACTTACAAGGAAGATATCTATTCTCATGGAGGAGAGCTCTACTATGAATGAAGCAGAGTTTTCAGCTCCATACTTGTTGCATGAAATCGAACGAATGAAGGGAGATATCAAACAGATCATTTTGAAAGCGCCAGAGTCATCCCAACTTTGCTTTCCTATGGATGATGGTTTCCTCTTCATGAATCTTCTACTCCGCCATTTAAATGATTTACTCACTTCCAATTCTTATTCAGTTTCTCTGATAAAAAAAGAAATTGAGATGGTGAAACAAAGCCTTGAATTCCTAACAGCATCTTTCAGGCAAACATTGGATGAGAGCACTAGTGGAGTTGTTAAAGATTGTTGGATGTGTGCTTTGGATGTGGCATATGAGGCAGAACATGTCATTAATTCCATTCTTGTCAGAGATAAAGCTCTCTCGCACCTCCTCTTCTCACTTCCGGATGTCATTGATAAGATCAAGTTTATCGTGGCACAAGTCACCGGCTTACAGCTGGAGGCTAAGAATGGCGATGATCCCCTTGATGCAAAGTCTTCCTACGAGCCAATTGAGTTAACCTCATCATCATTTGTTGAGGTAACAGTAGGTCATGAGGAAGATGAAGCCCGGATCATTGGCCAGCTCCTTGATGAACATGAATCCAAGCTTGATGTCATTTCCATTGTCGGAATGCCAGGAGTCGGTAAAACTACTCTTGCCAATAAAGTGTATAACAATACATTAGTTGCTAGTCATTTCAAGATTCGTGCTAAGTGCACTGTTTCCCAAAACTTTAACAAGTCAAAGGTGTTGCGGGAGATTCTTCAGCAAGTTACTGCCTCGGAGACAAACAGAAGTGAGGATGACCTTGCTGAAAAGCTACGAGTAGCACTACTCGATAAAAGGTACCTCATCGTCTTGGATGATGTGTGGGATATTGCAACAGGGGAGATGTTAATAGCATGTTTTCCAAAGGTTGAGAGAGGAAATAGAGTTATCTTAACTAGCCGAAGTGGTGAGGTAGGTTTGAAAGTTAAATGCCGTAGTGATCCTGTGGACCTCCAAGTTTTAACAGATGAAAAAAGTTGGGAGTTATTCGAAAAAAGGGTATTTAGAGATGAAGGAAGCTGCCCTGCTGAACTGTTGGATATTGGACACCAAATTGTTGAGAAATGTAAAGGGCTTCCTTTGGCTCTTGTTTTGATTGCTGGAGTGATTGTTAGAGGAAGGGAAGGAAAGGAAAAGGAAAAGGAAAAAGATTTTTGGGTTAAGATTCAAAATAATTTGGATTCCTTTACTTCTTCCAACATCAATTCGCAGATTATGAATGTTATGCAATCAAGTTATGACCATTTACCATACCAGCTGAAGCCGTTGTTGCTTTACTTTGCAAGATTGCAAAAGAGCGAACGAACTCCAGTCTCTATGTTGATGCAGTTGTGGATGGCTGAAGGGTTGGTGGATCATGATATTCCATCCAAGTGTAGTTTAGAGGAAGTAACTGAAAGTTACTTGGATGCTTTAATTTCCAGTAGTCTGATAATGGTGGATCATATCCGCTCTGTGAGTAATTGGACGTCTGTAATGATGAGAGCTTGCTATGTGCATGATGTTGTGCATGATTTTTGTTCAGTAAAAGCGGGAAAGGAAAAGTTTTTCAAGTTGATCAATTCAGGTGATCCATTTCATGCTTCTGATTTCTTGCACCATCGACTAACCATTCATACTGACGACAAAAAATGTGTCTTGTTTAATTCTAATAAGTGTTCTGCTGGTAGTAAGCATCTCATATCTTTGGAAGTGAGCAGTTCGCTGGATAACTCCGGGTATATTTTTCACACAAGACACATGAGACTTGTTAGAGTGTTGCAACTGGATGACATTGTTCTGCAACATCATTTAGTGGAAGAAATAGGGTCCCTATTTCATTTGAGGTTCTTAAAGATTTGGACTCGTGATGTAAAAGCTATCCCATTGTCATGGTTGAACCTCCAGAATCTGGAAACTTTGCTGATCAGTGAGGAATTTTCCACCATTGTTTTACTGCCAAGATTATTCAAACTGTCAAAGCTGAAACATGTGAGCATTGACCAGAGTTCTTTCTTTGATAAAGAGGAAGTGGAAGTGGAAGTGGAAGAGGAAGAGGAAGTGGAAGTGGAAGTGGAAGAGGAAGACGAAGACAAAGAGGAAGAGGACACGGACAATATCCAAAGCAGAATATTGGAAGGTGAGAATTCAAAGCTGACAACTTTATCCAAAGTTGATATCTCATATTCCCAAGGAACTAATGATGCTCTAGAGAAGTTCCAAAATCTTGAGCACCTTGATTGCACCATCATTGTACCCGAGTGTCCTCCTAAACACGGCGATTGGTTTCCCAAGTTTGATGTCCTTAATAAACTTCAATCGCTCACTGCAGTATACAAATGGAGTCATTATGGTTATCCCATTATTGAATATCACTTCCCTACCAGCTTGAAAGACTTGCGGTTGCATTCTTTTCCCATCACACCTGCTTTGTTGTCAGTAATCGCGGCATTACCTCAGCTTGAAATTCTGGCGATTTTTTACTCTGATTTCATGGAGGATAAGTGGGATGCAAGTAAGGACATCTATCAAAGTCTTAAAACTTTGAGTTTGTCATATATCAAATTATCAGAATGGGAAGTTGATAGGAGCGAAACTTTTCCCAAGCTTGAGGAATTAATACTAGAACGTTGTTACAAGCTTACGGAGATCCCTTCTGCATTCGAGGATATAGAAACTTTAAAGATCATTCATTTAACTAATATTAAGCGTGAGCTTGGAGATTCAGCCATTGAGATTAAGAAACAGATAGTAGAAATCACAGGAGTGGACAGACTTCAAGTTCATCTATCAGGTTTGTATGAATAA


Protein sequences

Name Description Sequence
hero resistance protein hero resistance protein [Solanum lycopersicum].

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDFYYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDLPKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEYAFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYSATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKGDIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDESTSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKSSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSVKAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNSGYIFHTRHMRLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLSKLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQGTNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHSFPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILERCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
370-861 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDESTSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKSSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDF

HMMPanther: PTHR11017:SF126
370-861 PTHR11017:SF126,OS11G0237600 PROTEIN

PESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDESTSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKSSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDF

superfamily: SSF52540
504-748 SSF52540

SSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNL

HMMPfam: PF00931
IPR002182
528-807 NB-ARC,NBS
NB-ARC

ARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVD

Gene3D: G3DSA:3.40.50.300
530-638 G3DSA:3.40.50.300

IIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEML

HMMSmart: SM00382
IPR003593
541-677 AAA,NBS
AAA+ ATPase domain

KLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLT

FPrintScan: PR00364
IPR000767
544-559 DISEASERSIST
Disease resistance protein

VISIVGMPGVGKTTLA

FPrintScan: PR00364
IPR000767
616-630 DISEASERSIST
Disease resistance protein

ALLDKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
711-725 DISEASERSIST
Disease resistance protein

CKGLPLALVLIAGVI

superfamily: SSF52058
817-1249 SSF52058,LRR

EEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSVKAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNSGYIFHTRHMRLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLSKLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQGTNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHSFPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILERCYKLTEIPSAFEDIETLKIIHLTN

Gene3D: G3DSA:3.80.10.10
835-861 G3DSA:3.80.10.10

VDHIRSVSNWTSVMMRACYVHDVVHDF

Gene3D: G3DSA:3.80.10.10
933-1016 G3DSA:3.80.10.10

TRHMRLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLSKLKHVSID

Gene3D: G3DSA:3.80.10.10
1053-1094 G3DSA:3.80.10.10

DNIQSRILEGENSKLTTLSKVDISYSQGTNDALEKFQNLEHL

Gene3D: G3DSA:3.80.10.10
1145-1250 G3DSA:3.80.10.10

LKDLRLHSFPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILERCYKLTEIPSAFEDIETLKIIHLTNI

FPrintScan: PR00364
IPR000767
1213-1229 DISEASERSIST
Disease resistance protein

ETFPKLEELILERCYKL


Diseases

Disease Pathogen Avirulence gene
Yellow potato cyst nematode Globodera

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox