PRGDB00000040 (Hero)

From PRG Wiki
Jump to: navigation, search
Hero
Gene Type Reference_R-Genes,_manually_curated
GenBank 23095860 (AJ457052)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 4
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum hero gene for hero resistance protein, exons 2-3.

DNA Sequence

ATGGAAAAAGGAGAAAAACCATTGCTACTATTTGAGGAACAAAAAAAAAGAATCACGAATCTTATTGATGATTTCTTGAATGGTTTGAAGCAAATAATGAACGAAGAAGAAGAATTCATTGCTTCAAAATTGGATGTGATTCAAAAGCTAAGAATGGATCTAAGATTACTTAGAACATTTGTCTTGTTTGGGAATTCGACGAATTTGGATGACTTTTATTACAGGATGAATATTCATATAAACAAATTCAATATACTTACTGAGACCCTTTTCTGTAAAGATGATTTAATCCTAGAGAAATACCACATGGAATGTGTTGCCCCTCTGCTGCTGAAAGAGATAAGAAATTATTTGAGTTTGAAGAATGATTATGTAGCCACGGCGATAGAGATGAAGAAGTTTGAATACCTCATCAGAAATCTCCATGATCTACCAAAGTATTGTTATGATTTGCTTCAACCCCTCATGAGTGAATACAAGATTCTTCGGCAAGTATGCACACATCTCAGAGATTTCTATCAGTTGGAATGCAACAAAACAACAAAAACAGAATTTCTCTATACTCGGTATCAAGTGACAGTTGATAGAGTAACACAATTCTGTTTTGATCTTTGGACTGGAAAGTACAGAAACTATAGATACGAGTATGCCTTCTCTAAATGCTCTTCCAAGATCACTTCTCTACTCATCGACATAATCCCTCTTGAGCTGGAGGTTCTACACATTTCTACTTCTAACCTCATCAAAGAATCAAGGTCAAAAGAACTAGAAGGATTTGTTAAGCAAATCCTAAAAGCATCTCCAAGGATTCTTCAAAAGCATCTCATTCATCTCCAAGGACGCATGGTAGCCGACAGTTACTCTGCAACTCAAAGCATTAATGTCATGATGGAGTTCCTGTTGATCTTTCTCACTGATATACCAAAGCGCTTTATCCATCGTGGCAAATTGAACTCTATGTTGGCACATGTCGGACTACTTACAAGGAAGATATCTATTCTCATGGAGGAGAGCTCTACTATGAATGAAGCAGAGTTTTCAGCTCCATACTTGTTGCATGAAATCGAACGAATGAAGGGAGATATCAAACAGATCATTTTGAAAGCGCCAGAGTCATCCCAACTTTGCTTTCCTATGGATGATGGTTTCCTCTTCATGAATCTTCTACTCCGCCATTTAAATGATTTACTCACTTCCAATTCTTATTCAGTTTCTCTGATAAAAAAAGAAATTGAGATGGTGAAACAAAGCCTTGAATTCCTAACAGCATCTTTCAGGCAAACATTGGATGAGAGCACTAGTGGAGTTGTTAAAGATTGTTGGATGTGTGCTTTGGATGTGGCATATGAGGCAGAACATGTCATTAATTCCATTCTTGTCAGAGATAAAGCTCTCTCGCACCTCCTCTTCTCACTTCCGGATGTCATTGATAAGATCAAGTTTATCGTGGCACAAGTCACCGGCTTACAGCTGGAGGCTAAGAATGGCGATGATCCCCTTGATGCAAAGTCTTCCTACGAGCCAATTGAGTTAACCTCATCATCATTTGTTGAGGTAACAGTAGGTCATGAGGAAGATGAAGCCCGGATCATTGGCCAGCTCCTTGATGAACATGAATCCAAGCTTGATGTCATTTCCATTGTCGGAATGCCAGGAGTCGGTAAAACTACTCTTGCCAATAAAGTGTATAACAATACATTAGTTGCTAGTCATTTCAAGATTCGTGCTAAGTGCACTGTTTCCCAAAACTTTAACAAGTCAAAGGTGTTGCGGGAGATTCTTCAGCAAGTTACTGCCTCGGAGACAAACAGAAGTGAGGATGACCTTGCTGAAAAGCTACGAGTAGCACTACTCGATAAAAGGTACCTCATCGTCTTGGATGATGTGTGGGATATTGCAACAGGGGAGATGTTAATAGCATGTTTTCCAAAGGTTGAGAGAGGAAATAGAGTTATCTTAACTAGCCGAAGTGGTGAGGTAGGTTTGAAAGTTAAATGCCGTAGTGATCCTGTGGACCTCCAAGTTTTAACAGATGAAAAAAGTTGGGAGTTATTCGAAAAAAGGGTATTTAGAGATGAAGGAAGCTGCCCTGCTGAACTGTTGGATATTGGACACCAAATTGTTGAGAAATGTAAAGGGCTTCCTTTGGCTCTTGTTTTGATTGCTGGAGTGATTGTTAGAGGAAGGGAAGGAAAGGAAAAGGAAAAGGAAAAAGATTTTTGGGTTAAGATTCAAAATAATTTGGATTCCTTTACTTCTTCCAACATCAATTCGCAGATTATGAATGTTATGCAATCAAGTTATGACCATTTACCATACCAGCTGAAGCCGTTGTTGCTTTACTTTGCAAGATTGCAAAAGAGCGAACGAACTCCAGTCTCTATGTTGATGCAGTTGTGGATGGCTGAAGGGTTGGTGGATCATGATATTCCATCCAAGTGTAGTTTAGAGGAAGTAACTGAAAGTTACTTGGATGCTTTAATTTCCAGTAGTCTGATAATGGTGGATCATATCCGCTCTGTGAGTAATTGGACGTCTGTAATGATGAGAGCTTGCTATGTGCATGATGTTGTGCATGATTTTTGTTCAGTAAAAGCGGGAAAGGAAAAGTTTTTCAAGTTGATCAATTCAGGTGATCCATTTCATGCTTCTGATTTCTTGCACCATCGACTAACCATTCATACTGACGACAAAAAATGTGTCTTGTTTAATTCTAATAAGTGTTCTGCTGGTAGTAAGCATCTCATATCTTTGGAAGTGAGCAGTTCGCTGGATAACTCCGGGTATATTTTTCACACAAGACACATGAGACTTGTTAGAGTGTTGCAACTGGATGACATTGTTCTGCAACATCATTTAGTGGAAGAAATAGGGTCCCTATTTCATTTGAGGTTCTTAAAGATTTGGACTCGTGATGTAAAAGCTATCCCATTGTCATGGTTGAACCTCCAGAATCTGGAAACTTTGCTGATCAGTGAGGAATTTTCCACCATTGTTTTACTGCCAAGATTATTCAAACTGTCAAAGCTGAAACATGTGAGCATTGACCAGAGTTCTTTCTTTGATAAAGAGGAAGTGGAAGTGGAAGTGGAAGAGGAAGAGGAAGTGGAAGTGGAAGTGGAAGAGGAAGACGAAGACAAAGAGGAAGAGGACACGGACAATATCCAAAGCAGAATATTGGAAGGTGAGAATTCAAAGCTGACAACTTTATCCAAAGTTGATATCTCATATTCCCAAGGAACTAATGATGCTCTAGAGAAGTTCCAAAATCTTGAGCACCTTGATTGCACCATCATTGTACCCGAGTGTCCTCCTAAACACGGCGATTGGTTTCCCAAGTTTGATGTCCTTAATAAACTTCAATCGCTCACTGCAGTATACAAATGGAGTCATTATGGTTATCCCATTATTGAATATCACTTCCCTACCAGCTTGAAAGACTTGCGGTTGCATTCTTTTCCCATCACACCTGCTTTGTTGTCAGTAATCGCGGCATTACCTCAGCTTGAAATTCTGGCGATTTTTTACTCTGATTTCATGGAGGATAAGTGGGATGCAAGTAAGGACATCTATCAAAGTCTTAAAACTTTGAGTTTGTCATATATCAAATTATCAGAATGGGAAGTTGATAGGAGCGAAACTTTTCCCAAGCTTGAGGAATTAATACTAGAACGTTGTTACAAGCTTACGGAGATCCCTTCTGCATTCGAGGATATAGAAACTTTAAAGATCATTCATTTAACTAATATTAAGCGTGAGCTTGGAGATTCAGCCATTGAGATTAAGAAACAGATAGTAGAAATCACAGGAGTGGACAGACTTCAAGTTCATCTATCAGGTTTGTATGAATAA


Protein sequences

Name Description Sequence
hero resistance protein hero resistance protein [Solanum lycopersicum].

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDFYYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDLPKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEYAFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYSATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKGDIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDESTSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKSSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSVKAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNSGYIFHTRHMRLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLSKLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQGTNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHSFPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILERCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
370-861 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDESTSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKSSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDF

HMMPanther: PTHR11017:SF126
370-861 PTHR11017:SF126,OS11G0237600 PROTEIN

PESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDESTSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKSSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDF

superfamily: SSF52540
504-748 SSF52540

SSYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNL

HMMPfam: PF00931
IPR002182
528-807 NB-ARC,NBS
NB-ARC

ARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVLIAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTPVSMLMQLWMAEGLVD

Gene3D: G3DSA:3.40.50.300
530-638 G3DSA:3.40.50.300

IIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEML

HMMSmart: SM00382
IPR003593
541-677 AAA,NBS
AAA+ ATPase domain

KLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRAKCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERGNRVILTSRSGEVGLKVKCRSDPVDLQVLT

FPrintScan: PR00364
IPR000767
544-559 DISEASERSIST
Disease resistance protein

VISIVGMPGVGKTTLA

FPrintScan: PR00364
IPR000767
616-630 DISEASERSIST
Disease resistance protein

ALLDKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
711-725 DISEASERSIST
Disease resistance protein

CKGLPLALVLIAGVI

superfamily: SSF52058
817-1249 SSF52058,LRR

EEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSVKAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNSGYIFHTRHMRLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLSKLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQGTNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHSFPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILERCYKLTEIPSAFEDIETLKIIHLTN

Gene3D: G3DSA:3.80.10.10
835-861 G3DSA:3.80.10.10

VDHIRSVSNWTSVMMRACYVHDVVHDF

Gene3D: G3DSA:3.80.10.10
933-1016 G3DSA:3.80.10.10

TRHMRLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLSKLKHVSID

Gene3D: G3DSA:3.80.10.10
1053-1094 G3DSA:3.80.10.10

DNIQSRILEGENSKLTTLSKVDISYSQGTNDALEKFQNLEHL

Gene3D: G3DSA:3.80.10.10
1145-1250 G3DSA:3.80.10.10

LKDLRLHSFPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILERCYKLTEIPSAFEDIETLKIIHLTNI

FPrintScan: PR00364
IPR000767
1213-1229 DISEASERSIST
Disease resistance protein

ETFPKLEELILERCYKL


Diseases

Disease Pathogen Avirulence gene
Yellow potato cyst nematode Globodera

List of References

Karin Ernst, Amar Kumar, Doris Kriseleit, Dorothee-U Kloos, Mark S Phillips, Martin W Ganal
The broad-spectrum potato cyst nematode resistance gene (Hero) from tomato is the only member of a large gene family of NBS-LRR genes with an unusual amino acid repeat in the LRR region.
Plant J.: 2002, 31(2);127-36
PubMed:12121443 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox