PRGDB00000045 (Prf)

From PRG Wiki
Jump to: navigation, search
Prf
Gene Type Reference_R-Genes,_manually_curated
GenBank 8547226 (AF220602)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 5
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Rio Grande 76R Pto locus, complete sequence.

DNA Sequence

ATGGCCAAGGAGTGTCGCGATGCAATAGGTACTATAAACCTTGTGAAGGGCCAGCATTTAGACAGAAGGACCACTAATCAATTGGAGGATGCTATAAAGCACCTAACACATGTTGCTGTATTTCTCACAAATCTGGAGAAGCGTCACCCTGCTAATGGAATATCTATACATCTTAGGCCTCTATTTTTAGAAGCTCATGATGGCTTTTCTCTGATGTGTTCTCATCCTCCTCGTTCTCAGTTTACCGTTAAACTGGATAACATTGCTGAGAAATTCAAATCTTCAAAGGCGTCAAGATCAACAAGGCAAGTGATCCCAGAGCTGCTGCAAATAATTGAACCCGAGAATATTGCTAAGCGAATCAAAGCTTCAAAGCCATCAAGATCATCTAGCCCAATCACTGTGGATATGGTGGGGTTTATCGAATCCTTGCTTGGTTCTGTTCATCGTGCATTGTTCTTTATCAGTGCAGGGCCTCCTGTGTCTATGCTTGACAAGAAGCTTCGACATCTACAAGTCTTCTTTAGACTAATTTCAAAGCGGGGCATTGAGCATGAGAGTATGAAGGATCTCTTCTACCATGTTGAGGATGTAGCTTACACTGCAGCACAACTATGTGTCTTGGGGTCGAGCTGCCATATGGATGACGAGTTCTCTAAATTTCTGGAAAGGATAAGTCGTCCTTTTAGCCCAGGATTGAGGCAGGTTTATCTCAATGCCTTGATAGGGTTAAATTCATCAAGATCAAAGACTACAATGAATGCCAAATATATGCTTGATTTTGTTAGTGCTCTCCAAGATGATCTGAGACTAAGATGTGATAATCGAATTCGATGGCTCCAACGAGGACTTTCTTACCTTTGTCGATTCCTCAGGGACATAGAATCTTATCCTGTTTCACATCGACAACTGATTTCTCTTCAATTGAATATGGAAGATCTGGCTATTGGGTCTGCAAATGCCATCTACTCCTATGATGAGGATATGGATAAGACTAGTGAAATAGACCATGAGCTTTTTCATTTGCAAATGAAGTTTAATTATGTTAAAGTAGAGGTTGATCTGATTCGTCTACAAAACATTCAAGGCACCATAATAGTTCCTATGAAAGATCTGATTGACTATGTTTGGGAAGAGCTGATGTTCTTTAGAAGTTATTTCATGGATGCATTCGACCAGTTTAAAGAGCAGACCAGGATAACTGTTATTTTGAACTATATTCAGTCTGCAGTTAGTCAAGCATGGTCAGTCTGTGATTCTCTTTGTCATGACTTGAATCAAAATGACTTGGCCAGGGAAATTAATTGCTTGCATTTTCAATTGCTTCTTAAGTTCAAGTTTATCAAGGTCGCTATTAGACAGATGTGTCCCAGCATTTCTGCATCATCAACACCAGACCATCCAATGATAGATCTGCTGAACTTTCTTCCCATGAACTTTGAGGCCATTGATTCCTATTCCAGCATGCTAAAAGCCTCCTGTCCATCTTCCTCACATCGTCCTAATAGGGATGCGGAATCCCCCAATACATCATTCTTATGTGGTCCCAATACAGATGTGTACTCCTTCTATTCATCATCCTCACGTATTCCCAAGATGGATGAGATATTGAAGAGGTTTCATGAATATATTCTTGTCAATCTGCTACGGAAGGATGAAACCAATTTGACATTTACTATTGCAGATGAGGTCAAAAAGTTTTATGATGGGTTGTTGCTCATGGTTACATATCTTATTGAACCTCCAGTTCCTCACACTGAATGCAGGAAGCAAAATGATCTCTCAATGCGACATGAAGCTGTTGCAATTGAGGCGGAATCTGCTGTGTGTTTACATTATGAGGATAATATGAATAACAACAGTAGGGAGATCAATCAGGTACTTCAGTTTTTGACTGTGACTTTCTGGCTTATCAAGTCTGAGGGTAACTTGATGGATCTACTGAAGCACAAATCCACTTTGGGAAATCAAGTTCTAGATCTGATTGAGAGTGCTCATGAAGAGCTTATTCTCCTTAGATCTATTCTCATGGATCTTCTTAGGAAAAAGCTTTACAGATTGGATGATCTCTTAATGCATGCTGAGGTGACTGCAAAAAGGTTAGCAATATTCAGTGGTTCTTGTTATGAATATTTCATGAACGGAAGCAGCACTGAGAAAATGAGGCCCTTGTTATCTGATTTTCTGCAAGAGATTGAGTCTGTCAAGGTAGAGTTCAGAAATGTTTGCTTGCAAGTTCTGGATATATCACCTTTTTCCCTGACAGATGGAGAAGGCCTTGTTAATTTCTTATTAAAAAACCAGGCCAAGGTGCCGAATGATGATGCTGTTTCTTCTGATGGAAGTTTAGAGGATGCAAGCAGCACTGAGAAAATGGGACTTCCATCTGATTTTCTCCGAGAGATTGAGTCTGTTGAGATAAAGGAGGCCAGAAAATTATATGATCAAGTTTTGGATGCAACACATTGTGAGACGAGTAAGACAGATGGAAAAAGCTTTATCAACATTATGTTAACCCAACAGGACAAGTTGCCGGACTATGATGCTGGTTCAGTCTCTTATCTTCTTAACCAAATATCAGTAGTTAAAGACAAACTATTGCACATTGGCTCTTTACTTGTAGATATTGTACAGTACCGGAATATGCATATAGAACTTACAGATCTCGCTGAACGTGTTCAAGATAAAAACTACATTTGTTTCTTCTCTGTCAAGGGTTATATTCCTGCTTGGTATTACACACTATATCTCTCTGATGTCAAGCAATTGCTTAAGTTTGTTGAGGCAGAGGTAAAGATTATTTGTCTGAAAGTACCAGATTCTTCAAGTTATAGCTTCCCTAAGACAAATGGATTAGGATATCTCAATTGCTTTTTAGGCAAATTGGAGGAGCTTTTACGTTCTAAGCTCGATTTGATAATCGACTTAAAACATCAGATTGAATCAGTCAAGGAGGGCTTATTGTGCCTAAGATCATTCATTGATCATTTTTCAGAAAGCTATGATGAGCATGATGAAGCTTGTGGTCTTATAGCAAGAGTTTCTGTAATGGCATACAAGGCTGAGTATGTCATTGACTCATGCTTGGCCTATTCTCATCCACTCTGGTACAAAGTTCTTTGGATTTCTGAAGTTCTTGAGAATATTAAGCTTGTAAATAAAGTTGTTGGTGAGACATGTGAAAGAAGGAACATTGAAGTTACTGTGCATGAAGTTGCAAAGACTACCACTTATGTAGCACCATCTTTTTCAGCTTATACTCAAAGAGCAAACGAAGAAATGGAGGGTTTTCAGGATACAATAGATGAATTAAAGGATAAACTACTTGGAGGATCACCTGAGCTTGATGTCATCTCAATCGTTGGCATGCCAGGATTGGGCAAGACTACACTAGCAAAGAAGATTTACAATGATCCAGAAGTCACCTCTCGCTTCGATGTCCATGCTCAATGTGTTGTGACTCAATTATATTCATGGAGAGAGTTGTTGCTCACCATTTTGAATGATGTCCTTGAGCCTTCTGATCGCAATGAAAAAGAAGATGGTGAAATAGCTGATGAGTTACGCCGATTTTTGTTGACCAAGAGATTCTTGATTCTCATTGATGATGTGTGGGACTATAAAGTGTGGGACAATCTATGTATGTGCTTCAGTGATGTTTCAAATAGGAGTAGAATTATCCTAACAACCCGCTTGAATGATGTCGCCGAATATGTCAAATGTGAAAGTGATCCCCATCATCTTCGTTTATTCAGAGATGACGAGAGTTGGACATTATTACAGAAAGAAGTCTTTCAAGGAGAGAGCTGTCCACCTGAACTTGAAGATGTGGGATTTGAAATATCAAAAAGTTGTAGAGGGTTGCCTCTCTCAGTTGTGTTAGTAGCTGGTGTTCTGAAACAGAAAAAGAAGACACTAGATTCATGGAAAGTAGTAGAACAAAGTCTAAGTTCCCAGAGGATTGGCAGCTTGGAAGAGAGCATATCTATAATTGGATTCAGTTACAAGAATTTACCACACTATCTTAAGCCTTGTTTTCTCTATTTTGGAGGATTTTTGCAGGGAAAGGATATTCATGTCTCAAAAATGACCAAGTTGTGGGTAGCTGAAGGGTTTGTACAAGCAAACAACGAAAAAGGACAAGAAGATACCGCACAAGGTTTCTTGGACGATCTTATTGGTAGGAATGTAGTGATGGCCATGGAGAAGAGACCTAATACCAAGGTGAAAACGTGCCGCATTCATGATTTGTTGCATAAATTCTGCATGGAAAAGGCCAAACAAGAGGATTTTCTTCTCCAAATCAATAGTGGAGAAGGTGTATTTCCTGAACGATTGGAGGAATACCGATTGTTCGTTCATTCTTACCAAGATGAAATTGATCTGTGGCGCCCATCTCGCTCTAATGTCCGATCTTTACTATTCAATGCAATTGATCCAGATAACTTGTTATGGCCGCGTGATATCTCCTTCATTTTTGAGAGCTTCAAGCTTGTTAAAGTGTTGGATTTGGAATCATTCAACATTGGTGGTACTTTTCCCACTGAAATACAATATCTAATTCAGATGAAGTACTTTGCGGCCCAAACTGATGCAAATTCAATTCCTTCATCTATAGCTAAGCTTGAAAATCTTGAGACTTTTGTCGTAAGAGGATTGGGAGGAGAGATGATATTACCTTGTTCACTTCTGAAGATGGTGAAATTGAGGCATATACATGTAAATGATCGGGTTTCTTTTGGTTTGCATGAGAACATGGATGTTTTAACTGGTAACTCACAATTACCTAATTTGGAAACCTTTTCTACTCCACGTCTCTTTTATGGTAAAGACGCAGAGAAGGTTTTGAGGAAGATGCCAAAATTGAGAAAATTGAGTTGCATATTTTCAGGGACATTTGGTTATTCAAGGAAATTGAAGGGTAGGTGTGTTCGTTTTCCCAGATTAGATTTTCTAAGTCACCTTGAGTCCCTCAAGCTGGTTTCGAACAGCTATCCAGCCAAACTTCCTCACAAGTTCAATTTCCCCTCGCAACTAAGGGAACTGACTTTATCAAAGTTCCGTCTACCTTGGACCCAAATTTCGATCATTGCAGAACTGCCCAACTTGGTAATTCTTAAGTTATTGCTCAGAGCCTTTGAAGGGGATCACTGGGAAGTGAAAGATTCAGAGTTCCTAGAACTCAAATACTTAAAACTGGACAACCTCAAAGTTGTACAATGGTCCATCTCTGATGATGCTTTTCCTAAGCTTGAACATTTGGTTTTAACGAAATGTAAGCATCTTGAGAAAATCCCTTCTCGTTTTGAAGATGCTGTTTGCCTAAATAGAGTTGAGGTGAACTGGTGCAACTGGAATGTTGCCAATTCAGCCCAAGATATTCAAACTATGCAACATGAAGTTATAGCAAATGATTCATTCACAGTTACTATACAGCCTCCAGATTGGTCTAAAGAACAGCCCCTTGACTCTTAG


Protein sequences

Name Description Sequence
Prf Prf [Lycopersicon pimpinellifolium].

MAKECRDAIGTINLVKGQHLDRRTTNQLEDAIKHLTHVAVFLTNLEKRHPANGISIHLRPLFLEAHDGFSLMCSHPPRSQFTVKLDNIAEKFKSSKASRSTRQVIPELLQIIEPENIAKRIKASKPSRSSSPITVDMVGFIESLLGSVHRALFFISAGPPVSMLDKKLRHLQVFFRLISKRGIEHESMKDLFYHVEDVAYTAAQLCVLGSSCHMDDEFSKFLERISRPFSPGLRQVYLNALIGLNSSRSKTTMNAKYMLDFVSALQDDLRLRCDNRIRWLQRGLSYLCRFLRDIESYPVSHRQLISLQLNMEDLAIGSANAIYSYDEDMDKTSEIDHELFHLQMKFNYVKVEVDLIRLQNIQGTIIVPMKDLIDYVWEELMFFRSYFMDAFDQFKEQTRITVILNYIQSAVSQAWSVCDSLCHDLNQNDLAREINCLHFQLLLKFKFIKVAIRQMCPSISASSTPDHPMIDLLNFLPMNFEAIDSYSSMLKASCPSSSHRPNRDAESPNTSFLCGPNTDVYSFYSSSSRIPKMDEILKRFHEYILVNLLRKDETNLTFTIADEVKKFYDGLLLMVTYLIEPPVPHTECRKQNDLSMRHEAVAIEAESAVCLHYEDNMNNNSREINQVLQFLTVTFWLIKSEGNLMDLLKHKSTLGNQVLDLIESAHEELILLRSILMDLLRKKLYRLDDLLMHAEVTAKRLAIFSGSCYEYFMNGSSTEKMRPLLSDFLQEIESVKVEFRNVCLQVLDISPFSLTDGEGLVNFLLKNQAKVPNDDAVSSDGSLEDASSTEKMGLPSDFLREIESVEIKEARKLYDQVLDATHCETSKTDGKSFINIMLTQQDKLPDYDAGSVSYLLNQISVVKDKLLHIGSLLVDIVQYRNMHIELTDLAERVQDKNYICFFSVKGYIPAWYYTLYLSDVKQLLKFVEAEVKIICLKVPDSSSYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVVGETCERRNIEVTVHEVAKTTTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKFCMEKAKQEDFLLQINSGEGVFPERLEEYRLFVHSYQDEIDLWRPSRSNVRSLLFNAIDPDNLLWPRDISFIFESFKLVKVLDLESFNIGGTFPTEIQYLIQMKYFAAQTDANSIPSSIAKLENLETFVVRGLGGEMILPCSLLKMVKLRHIHVNDRVSFGLHENMDVLTGNSQLPNLETFSTPRLFYGKDAEKVLRKMPKLRKLSCIFSGTFGYSRKLKGRCVRFPRLDFLSHLESLKLVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVTIQPPDWSKEQPLDS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
943-1436 PTHR11017:SF126,OS11G0237600 PROTEIN

SYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVVGETCERRNIEVTVHEVAKTTTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKFCMEKAKQEDFLLQIN

HMMPanther: PTHR11017
943-1436 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVVGETCERRNIEVTVHEVAKTTTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKFCMEKAKQEDFLLQIN

HMMPfam: PF12061
IPR021929
943-1056 DUF3542
Late blight resistance protein R1

SYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVV

superfamily: SSF52540
1076-1324 SSF52540

TTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSL

HMMPfam: PF00931
IPR002182
1098-1377 NB-ARC,NBS
NB-ARC

QDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANN

Gene3D: G3DSA:3.40.50.300
1110-1238 G3DSA:3.40.50.300

GGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEY

FPrintScan: PR00364
IPR000767
1117-1132 DISEASERSIST
Disease resistance protein

VISIVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
1191-1205 DISEASERSIST
Disease resistance protein

FLLTKRFLILIDDVW

FPrintScan: PR00364
IPR000767
1285-1299 DISEASERSIST
Disease resistance protein

CRGLPLSVVLVAGVL

superfamily: SSF52058
1413-1789 SSF52058,LRR

RIHDLLHKFCMEKAKQEDFLLQINSGEGVFPERLEEYRLFVHSYQDEIDLWRPSRSNVRSLLFNAIDPDNLLWPRDISFIFESFKLVKVLDLESFNIGGTFPTEIQYLIQMKYFAAQTDANSIPSSIAKLENLETFVVRGLGGEMILPCSLLKMVKLRHIHVNDRVSFGLHENMDVLTGNSQLPNLETFSTPRLFYGKDAEKVLRKMPKLRKLSCIFSGTFGYSRKLKGRCVRFPRLDFLSHLESLKLVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVAN

Gene3D: G3DSA:3.80.10.10
1488-1575 G3DSA:3.80.10.10

DISFIFESFKLVKVLDLESFNIGGTFPTEIQYLIQMKYFAAQTDANSIPSSIAKLENLETFVVRGLGGEMILPCSLLKMVKLRHIHVN

Gene3D: G3DSA:3.80.10.10
1622-1785 G3DSA:3.80.10.10

LRKLSCIFSGTFGYSRKLKGRCVRFPRLDFLSHLESLKLVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNW

FPrintScan: PR00364
IPR000767
1746-1762 DISEASERSIST
Disease resistance protein

DAFPKLEHLVLTKCKHL


Diseases

Disease Pathogen Avirulence gene
Bacterial Speck Pseudomonas syringae PRGAV00000036
Bacterial Speck Pseudomonas syringae pv. tomato PRGAV00000037

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox