PRGDB00000045 (Prf)

From PRG Wiki
Jump to: navigation, search
Prf
Gene Type Reference_R-Genes,_manually_curated
GenBank 8547226 (AF220602)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 5
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Rio Grande 76R Pto locus, complete sequence.

DNA Sequence

ATGGCCAAGGAGTGTCGCGATGCAATAGGTACTATAAACCTTGTGAAGGGCCAGCATTTAGACAGAAGGACCACTAATCAATTGGAGGATGCTATAAAGCACCTAACACATGTTGCTGTATTTCTCACAAATCTGGAGAAGCGTCACCCTGCTAATGGAATATCTATACATCTTAGGCCTCTATTTTTAGAAGCTCATGATGGCTTTTCTCTGATGTGTTCTCATCCTCCTCGTTCTCAGTTTACCGTTAAACTGGATAACATTGCTGAGAAATTCAAATCTTCAAAGGCGTCAAGATCAACAAGGCAAGTGATCCCAGAGCTGCTGCAAATAATTGAACCCGAGAATATTGCTAAGCGAATCAAAGCTTCAAAGCCATCAAGATCATCTAGCCCAATCACTGTGGATATGGTGGGGTTTATCGAATCCTTGCTTGGTTCTGTTCATCGTGCATTGTTCTTTATCAGTGCAGGGCCTCCTGTGTCTATGCTTGACAAGAAGCTTCGACATCTACAAGTCTTCTTTAGACTAATTTCAAAGCGGGGCATTGAGCATGAGAGTATGAAGGATCTCTTCTACCATGTTGAGGATGTAGCTTACACTGCAGCACAACTATGTGTCTTGGGGTCGAGCTGCCATATGGATGACGAGTTCTCTAAATTTCTGGAAAGGATAAGTCGTCCTTTTAGCCCAGGATTGAGGCAGGTTTATCTCAATGCCTTGATAGGGTTAAATTCATCAAGATCAAAGACTACAATGAATGCCAAATATATGCTTGATTTTGTTAGTGCTCTCCAAGATGATCTGAGACTAAGATGTGATAATCGAATTCGATGGCTCCAACGAGGACTTTCTTACCTTTGTCGATTCCTCAGGGACATAGAATCTTATCCTGTTTCACATCGACAACTGATTTCTCTTCAATTGAATATGGAAGATCTGGCTATTGGGTCTGCAAATGCCATCTACTCCTATGATGAGGATATGGATAAGACTAGTGAAATAGACCATGAGCTTTTTCATTTGCAAATGAAGTTTAATTATGTTAAAGTAGAGGTTGATCTGATTCGTCTACAAAACATTCAAGGCACCATAATAGTTCCTATGAAAGATCTGATTGACTATGTTTGGGAAGAGCTGATGTTCTTTAGAAGTTATTTCATGGATGCATTCGACCAGTTTAAAGAGCAGACCAGGATAACTGTTATTTTGAACTATATTCAGTCTGCAGTTAGTCAAGCATGGTCAGTCTGTGATTCTCTTTGTCATGACTTGAATCAAAATGACTTGGCCAGGGAAATTAATTGCTTGCATTTTCAATTGCTTCTTAAGTTCAAGTTTATCAAGGTCGCTATTAGACAGATGTGTCCCAGCATTTCTGCATCATCAACACCAGACCATCCAATGATAGATCTGCTGAACTTTCTTCCCATGAACTTTGAGGCCATTGATTCCTATTCCAGCATGCTAAAAGCCTCCTGTCCATCTTCCTCACATCGTCCTAATAGGGATGCGGAATCCCCCAATACATCATTCTTATGTGGTCCCAATACAGATGTGTACTCCTTCTATTCATCATCCTCACGTATTCCCAAGATGGATGAGATATTGAAGAGGTTTCATGAATATATTCTTGTCAATCTGCTACGGAAGGATGAAACCAATTTGACATTTACTATTGCAGATGAGGTCAAAAAGTTTTATGATGGGTTGTTGCTCATGGTTACATATCTTATTGAACCTCCAGTTCCTCACACTGAATGCAGGAAGCAAAATGATCTCTCAATGCGACATGAAGCTGTTGCAATTGAGGCGGAATCTGCTGTGTGTTTACATTATGAGGATAATATGAATAACAACAGTAGGGAGATCAATCAGGTACTTCAGTTTTTGACTGTGACTTTCTGGCTTATCAAGTCTGAGGGTAACTTGATGGATCTACTGAAGCACAAATCCACTTTGGGAAATCAAGTTCTAGATCTGATTGAGAGTGCTCATGAAGAGCTTATTCTCCTTAGATCTATTCTCATGGATCTTCTTAGGAAAAAGCTTTACAGATTGGATGATCTCTTAATGCATGCTGAGGTGACTGCAAAAAGGTTAGCAATATTCAGTGGTTCTTGTTATGAATATTTCATGAACGGAAGCAGCACTGAGAAAATGAGGCCCTTGTTATCTGATTTTCTGCAAGAGATTGAGTCTGTCAAGGTAGAGTTCAGAAATGTTTGCTTGCAAGTTCTGGATATATCACCTTTTTCCCTGACAGATGGAGAAGGCCTTGTTAATTTCTTATTAAAAAACCAGGCCAAGGTGCCGAATGATGATGCTGTTTCTTCTGATGGAAGTTTAGAGGATGCAAGCAGCACTGAGAAAATGGGACTTCCATCTGATTTTCTCCGAGAGATTGAGTCTGTTGAGATAAAGGAGGCCAGAAAATTATATGATCAAGTTTTGGATGCAACACATTGTGAGACGAGTAAGACAGATGGAAAAAGCTTTATCAACATTATGTTAACCCAACAGGACAAGTTGCCGGACTATGATGCTGGTTCAGTCTCTTATCTTCTTAACCAAATATCAGTAGTTAAAGACAAACTATTGCACATTGGCTCTTTACTTGTAGATATTGTACAGTACCGGAATATGCATATAGAACTTACAGATCTCGCTGAACGTGTTCAAGATAAAAACTACATTTGTTTCTTCTCTGTCAAGGGTTATATTCCTGCTTGGTATTACACACTATATCTCTCTGATGTCAAGCAATTGCTTAAGTTTGTTGAGGCAGAGGTAAAGATTATTTGTCTGAAAGTACCAGATTCTTCAAGTTATAGCTTCCCTAAGACAAATGGATTAGGATATCTCAATTGCTTTTTAGGCAAATTGGAGGAGCTTTTACGTTCTAAGCTCGATTTGATAATCGACTTAAAACATCAGATTGAATCAGTCAAGGAGGGCTTATTGTGCCTAAGATCATTCATTGATCATTTTTCAGAAAGCTATGATGAGCATGATGAAGCTTGTGGTCTTATAGCAAGAGTTTCTGTAATGGCATACAAGGCTGAGTATGTCATTGACTCATGCTTGGCCTATTCTCATCCACTCTGGTACAAAGTTCTTTGGATTTCTGAAGTTCTTGAGAATATTAAGCTTGTAAATAAAGTTGTTGGTGAGACATGTGAAAGAAGGAACATTGAAGTTACTGTGCATGAAGTTGCAAAGACTACCACTTATGTAGCACCATCTTTTTCAGCTTATACTCAAAGAGCAAACGAAGAAATGGAGGGTTTTCAGGATACAATAGATGAATTAAAGGATAAACTACTTGGAGGATCACCTGAGCTTGATGTCATCTCAATCGTTGGCATGCCAGGATTGGGCAAGACTACACTAGCAAAGAAGATTTACAATGATCCAGAAGTCACCTCTCGCTTCGATGTCCATGCTCAATGTGTTGTGACTCAATTATATTCATGGAGAGAGTTGTTGCTCACCATTTTGAATGATGTCCTTGAGCCTTCTGATCGCAATGAAAAAGAAGATGGTGAAATAGCTGATGAGTTACGCCGATTTTTGTTGACCAAGAGATTCTTGATTCTCATTGATGATGTGTGGGACTATAAAGTGTGGGACAATCTATGTATGTGCTTCAGTGATGTTTCAAATAGGAGTAGAATTATCCTAACAACCCGCTTGAATGATGTCGCCGAATATGTCAAATGTGAAAGTGATCCCCATCATCTTCGTTTATTCAGAGATGACGAGAGTTGGACATTATTACAGAAAGAAGTCTTTCAAGGAGAGAGCTGTCCACCTGAACTTGAAGATGTGGGATTTGAAATATCAAAAAGTTGTAGAGGGTTGCCTCTCTCAGTTGTGTTAGTAGCTGGTGTTCTGAAACAGAAAAAGAAGACACTAGATTCATGGAAAGTAGTAGAACAAAGTCTAAGTTCCCAGAGGATTGGCAGCTTGGAAGAGAGCATATCTATAATTGGATTCAGTTACAAGAATTTACCACACTATCTTAAGCCTTGTTTTCTCTATTTTGGAGGATTTTTGCAGGGAAAGGATATTCATGTCTCAAAAATGACCAAGTTGTGGGTAGCTGAAGGGTTTGTACAAGCAAACAACGAAAAAGGACAAGAAGATACCGCACAAGGTTTCTTGGACGATCTTATTGGTAGGAATGTAGTGATGGCCATGGAGAAGAGACCTAATACCAAGGTGAAAACGTGCCGCATTCATGATTTGTTGCATAAATTCTGCATGGAAAAGGCCAAACAAGAGGATTTTCTTCTCCAAATCAATAGTGGAGAAGGTGTATTTCCTGAACGATTGGAGGAATACCGATTGTTCGTTCATTCTTACCAAGATGAAATTGATCTGTGGCGCCCATCTCGCTCTAATGTCCGATCTTTACTATTCAATGCAATTGATCCAGATAACTTGTTATGGCCGCGTGATATCTCCTTCATTTTTGAGAGCTTCAAGCTTGTTAAAGTGTTGGATTTGGAATCATTCAACATTGGTGGTACTTTTCCCACTGAAATACAATATCTAATTCAGATGAAGTACTTTGCGGCCCAAACTGATGCAAATTCAATTCCTTCATCTATAGCTAAGCTTGAAAATCTTGAGACTTTTGTCGTAAGAGGATTGGGAGGAGAGATGATATTACCTTGTTCACTTCTGAAGATGGTGAAATTGAGGCATATACATGTAAATGATCGGGTTTCTTTTGGTTTGCATGAGAACATGGATGTTTTAACTGGTAACTCACAATTACCTAATTTGGAAACCTTTTCTACTCCACGTCTCTTTTATGGTAAAGACGCAGAGAAGGTTTTGAGGAAGATGCCAAAATTGAGAAAATTGAGTTGCATATTTTCAGGGACATTTGGTTATTCAAGGAAATTGAAGGGTAGGTGTGTTCGTTTTCCCAGATTAGATTTTCTAAGTCACCTTGAGTCCCTCAAGCTGGTTTCGAACAGCTATCCAGCCAAACTTCCTCACAAGTTCAATTTCCCCTCGCAACTAAGGGAACTGACTTTATCAAAGTTCCGTCTACCTTGGACCCAAATTTCGATCATTGCAGAACTGCCCAACTTGGTAATTCTTAAGTTATTGCTCAGAGCCTTTGAAGGGGATCACTGGGAAGTGAAAGATTCAGAGTTCCTAGAACTCAAATACTTAAAACTGGACAACCTCAAAGTTGTACAATGGTCCATCTCTGATGATGCTTTTCCTAAGCTTGAACATTTGGTTTTAACGAAATGTAAGCATCTTGAGAAAATCCCTTCTCGTTTTGAAGATGCTGTTTGCCTAAATAGAGTTGAGGTGAACTGGTGCAACTGGAATGTTGCCAATTCAGCCCAAGATATTCAAACTATGCAACATGAAGTTATAGCAAATGATTCATTCACAGTTACTATACAGCCTCCAGATTGGTCTAAAGAACAGCCCCTTGACTCTTAG


Protein sequences

Name Description Sequence
Prf Prf [Lycopersicon pimpinellifolium].

MAKECRDAIGTINLVKGQHLDRRTTNQLEDAIKHLTHVAVFLTNLEKRHPANGISIHLRPLFLEAHDGFSLMCSHPPRSQFTVKLDNIAEKFKSSKASRSTRQVIPELLQIIEPENIAKRIKASKPSRSSSPITVDMVGFIESLLGSVHRALFFISAGPPVSMLDKKLRHLQVFFRLISKRGIEHESMKDLFYHVEDVAYTAAQLCVLGSSCHMDDEFSKFLERISRPFSPGLRQVYLNALIGLNSSRSKTTMNAKYMLDFVSALQDDLRLRCDNRIRWLQRGLSYLCRFLRDIESYPVSHRQLISLQLNMEDLAIGSANAIYSYDEDMDKTSEIDHELFHLQMKFNYVKVEVDLIRLQNIQGTIIVPMKDLIDYVWEELMFFRSYFMDAFDQFKEQTRITVILNYIQSAVSQAWSVCDSLCHDLNQNDLAREINCLHFQLLLKFKFIKVAIRQMCPSISASSTPDHPMIDLLNFLPMNFEAIDSYSSMLKASCPSSSHRPNRDAESPNTSFLCGPNTDVYSFYSSSSRIPKMDEILKRFHEYILVNLLRKDETNLTFTIADEVKKFYDGLLLMVTYLIEPPVPHTECRKQNDLSMRHEAVAIEAESAVCLHYEDNMNNNSREINQVLQFLTVTFWLIKSEGNLMDLLKHKSTLGNQVLDLIESAHEELILLRSILMDLLRKKLYRLDDLLMHAEVTAKRLAIFSGSCYEYFMNGSSTEKMRPLLSDFLQEIESVKVEFRNVCLQVLDISPFSLTDGEGLVNFLLKNQAKVPNDDAVSSDGSLEDASSTEKMGLPSDFLREIESVEIKEARKLYDQVLDATHCETSKTDGKSFINIMLTQQDKLPDYDAGSVSYLLNQISVVKDKLLHIGSLLVDIVQYRNMHIELTDLAERVQDKNYICFFSVKGYIPAWYYTLYLSDVKQLLKFVEAEVKIICLKVPDSSSYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVVGETCERRNIEVTVHEVAKTTTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKFCMEKAKQEDFLLQINSGEGVFPERLEEYRLFVHSYQDEIDLWRPSRSNVRSLLFNAIDPDNLLWPRDISFIFESFKLVKVLDLESFNIGGTFPTEIQYLIQMKYFAAQTDANSIPSSIAKLENLETFVVRGLGGEMILPCSLLKMVKLRHIHVNDRVSFGLHENMDVLTGNSQLPNLETFSTPRLFYGKDAEKVLRKMPKLRKLSCIFSGTFGYSRKLKGRCVRFPRLDFLSHLESLKLVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANSAQDIQTMQHEVIANDSFTVTIQPPDWSKEQPLDS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
943-1436 PTHR11017:SF126,OS11G0237600 PROTEIN

SYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVVGETCERRNIEVTVHEVAKTTTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKFCMEKAKQEDFLLQIN

HMMPanther: PTHR11017
943-1436 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVVGETCERRNIEVTVHEVAKTTTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKFCMEKAKQEDFLLQIN

HMMPfam: PF12061
IPR021929
943-1056 DUF3542
Late blight resistance protein R1

SYSFPKTNGLGYLNCFLGKLEELLRSKLDLIIDLKHQIESVKEGLLCLRSFIDHFSESYDEHDEACGLIARVSVMAYKAEYVIDSCLAYSHPLWYKVLWISEVLENIKLVNKVV

superfamily: SSF52540
1076-1324 SSF52540

TTYVAPSFSAYTQRANEEMEGFQDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSL

HMMPfam: PF00931
IPR002182
1098-1377 NB-ARC,NBS
NB-ARC

QDTIDELKDKLLGGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESDPHHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVLKQKKKTLDSWKVVEQSLSSQRIGSLEESISIIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVSKMTKLWVAEGFVQANN

Gene3D: G3DSA:3.40.50.300
1110-1238 G3DSA:3.40.50.300

GGSPELDVISIVGMPGLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEIADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEY

FPrintScan: PR00364
IPR000767
1117-1132 DISEASERSIST
Disease resistance protein

VISIVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
1191-1205 DISEASERSIST
Disease resistance protein

FLLTKRFLILIDDVW

FPrintScan: PR00364
IPR000767
1285-1299 DISEASERSIST
Disease resistance protein

CRGLPLSVVLVAGVL

superfamily: SSF52058
1413-1789 SSF52058,LRR

RIHDLLHKFCMEKAKQEDFLLQINSGEGVFPERLEEYRLFVHSYQDEIDLWRPSRSNVRSLLFNAIDPDNLLWPRDISFIFESFKLVKVLDLESFNIGGTFPTEIQYLIQMKYFAAQTDANSIPSSIAKLENLETFVVRGLGGEMILPCSLLKMVKLRHIHVNDRVSFGLHENMDVLTGNSQLPNLETFSTPRLFYGKDAEKVLRKMPKLRKLSCIFSGTFGYSRKLKGRCVRFPRLDFLSHLESLKLVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVAN

Gene3D: G3DSA:3.80.10.10
1488-1575 G3DSA:3.80.10.10

DISFIFESFKLVKVLDLESFNIGGTFPTEIQYLIQMKYFAAQTDANSIPSSIAKLENLETFVVRGLGGEMILPCSLLKMVKLRHIHVN

Gene3D: G3DSA:3.80.10.10
1622-1785 G3DSA:3.80.10.10

LRKLSCIFSGTFGYSRKLKGRCVRFPRLDFLSHLESLKLVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWTQISIIAELPNLVILKLLLRAFEGDHWEVKDSEFLELKYLKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNW

FPrintScan: PR00364
IPR000767
1746-1762 DISEASERSIST
Disease resistance protein

DAFPKLEHLVLTKCKHL


Diseases

Disease Pathogen Avirulence gene
Bacterial Speck Pseudomonas syringae PRGAV00000036
Bacterial Speck Pseudomonas syringae pv. tomato PRGAV00000037

List of References

Jeff H Chang, Yin-Shan Tai, Adriana J Bernal, Daniel T Lavelle, Brian J Staskawicz, Richard W Michelmore
Functional analyses of the Pto resistance gene family in tomato and the identification of a minor resistance determinant in a susceptible haplotype.
Mol. Plant Microbe Interact.: 2002, 15(3);281-91
PubMed:11952131 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox