PRGDB00000046 (R1)

From PRG Wiki
Jump to: navigation, search
R1
Gene Type Reference_R-Genes,_manually_curated
GenBank 17432422 (AF447489)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 5
Gene Species Solanum demissum

Comment?

Solanum demissum late blight resistance protein (R1) gene, complete cds.

DNA Sequence

ATGAATTTCAACAATGAATTGTCTGATCTGAAAAATCGCTTCCTATTTAGGACGCTGAGAGCCCAGAAATGCTCGGATGTTGCAAGAGATCGAATAGATTTCTTTATATGGGAGTTAAAATTCCTTAATTGTTTTCTCCATTTGCAGAGCTTCGCTTTTGCAAGTGAATGTGGTATGCTAGATATCTCACAGAAAATGATAGAAATTTGCAAGAGGTTTAATACACCACCTCCACATAATTCATTTGCATACTGGAAGGAGGTAATTTGCAAGAGGCTGTGCGCTATTAGCATCCAGCCGGATGCTAGTTCAGATGATGGATTTGCATGCTGGAAGAAAGTAATTTGGAAGACTAAGCAAGAATTCAGAGCTAAATACTCCTTTCCAAAAACACTACTTGCAGACAACAAGGTATATGATGATGATGATACTAATCCCAAATTTGTGATGGAATTCATCGATGCTGTTGTGGGGAATCTCAATGTTCTAGTCAAGATCAATGATCCATCTTCATTGCTTTTTGTTCCAGGACCCAAGGAACAAATAGAACAAGTGTTAAAGGAGTTGAAGTTATTGAGATTTTTTGTCTGCTTTGTTTCAAACAAATGTATAGAGCCTCAATACCAACATACTACTTTTTATACTCACGCTTTAATTGAGGCTAGCCACATCGCAATGGTTGTGTGGTTGAATTTGCCAATCTATGGAAACAGAAATCAAGACTTGGCTTCAAGTGAAGTTAGTTGTTTGCTTTCTGATTTCATGGAAATGAAGATTAAGTCCATTCAGCCAGACATCAGCCGCAACAATATTTATATTGATGTCTTGAGGGCGTTGAAGTCAACCATACCACAAGCTCAAGATAAGCATGCTGCTGAGAGTGGCATTGTGGAGACTCCAACACACAATCTGATGGTTGGTTTGAGTGATCAAATGGCCAACCTTCAGGAGATGCTCTGCCTTCTAAGAGACAATCTCATTCATCTGCCAATACTAGATCTGGAATTTCATCTTCAAGATATGGATTCTGTTATTGTTGATGCCGGACTTCTTATTTACTCATTATATGATATCAAGGGGCAGAAGGAAGACACAACATTGGAGGATATCAACCAGGCACTTGGTTTTGATCTTCCCAGAAACATTGAGCCTATCAAGGCAATGATCAACCTTGTCATGCAAAAGGCATTTCAATGTAACTTGCCAAGGATTCATGGACTAGGTTATGTCGATTTTCTATTGAAAAACCTGAAGGATTTCCAAGGCCGTTATTCAGATTCACTCGATTTCCTCAAGAATCAACTTCAAGTTATTCAAACTGAATTTGAGAGCTTGCAACCTTTCTTGAAGGTTGTCGTAGAAGAGCCACACAATAAGCTCAAGACACTGAATGAAGATTGTGCTACACAGATAATTAGGAAAGCATATGAGGTGGAATATGTAGTTGATGCTTGTATAAACAAAGAGGTTCCTCAGTGGTGCATCGAGCGTTGGCTCCTGGATATCATAGAGGAGATTACTTGTATCAAAGCAAAGATTCAGGAAAAGAACACGGTTGAGGATACAATGAAGACTGTCATTGCTCGTACATCATCAAAACTGGCAAGGACTCCAAGGATGAATGAAGAGATTGTTGGGTTTGAGGATGTCATAGAAAATTTAAGAAAAAAACTACTGAATGGAACCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTTTAGGTAAGACGACTTTAGCCAACAGTCTCTATTCTGACAGGTCAGTTTTTTCTCAATTTGATATTTGTGCACAATGTTGTGTGTCTCAAGTATATTCTTATAAGGACTTAATATTGGCCTTGCTACGTGATGCTATTGGTGAGGGTTCTGTGCGTAGAGAACTTCATGCCAATGAATTAGCTGATATGCTTCGCAAAACTCTATTGCCCCGAAGGTACCTTATCCTTGTTGATGACGTGTGGGAAAATAGTGTTTGGGATGATTTAAGAGGTTGTTTTCCAGATGTCAATAACAGAAGCAGAATCATTCTAACAACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCATAGTGATCCCCTTCATCTTCGTATGTTTGACGAAGTTGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAAGAAAGCTGTTCCCCTCTCCTAAAAAATGTTGGGCTAAGAATAGCAAAAATGTGTGGACAACTACCTCTTTCAATTGTTCTGGTGGCTGGTATTCTGTCAGAGATGGAAAAGGAAGTAGAATGTTGGGAACAAGTGGCCAACAATTTGGGTTCCTACATTCACAATGACTCAAGAGCCATTGTAGACAAAAGTTATCATGTTTTACCTTGTCATCTTAAGTCTTGCTTCCTTTATTTTGGAGCATTTTTAGAAGATAGAGTGATTGACATTTCAAGGTTAATAAGGCTATGGATATCAGAAGCATTTATAAAAAGTAGTGAAGGCAGGAGGTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTTATTGGAAGAAATCTAGTAATGGTTACTCAGAGGTCCATTTCAGATGGTAAGGCGAAAGAATGTCGCCTTCATGATGTATTACTCGACTTCTGCAAGGAAAGAGCAGCTGAGGAGAATTTTCTACTATGGATAAATAGGGATCAGATTACCAAACCTTCTTCCTGTGTTTACTCTCACAAGCAGCATGCTCACTTGGCCTTCACTGAAATGCATAATCTTGTAGAATGGAGTGCGTCTTGCTCATTTGTTGGCTCGGTAGTACTTTCCAATAAATATGACTCATACTTTTCCACTCGTGACATATCCTCACTACATGATTTTTCAATTTCACGCATTTTACCAAATTTCAAGTTTCTAAAAGTGTTAGATTTGGAACACCGGGTTTTTATTGATTTTATTCCAACTGAGCTTGTTTACTTGAAGTATTTTTCTGCACACATTGAACAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAAAAGTCCAATATATGCGTTACGTTGCACGCTACTACTACCTAGTACAGTTTGGGATATGGTTAAATTGAGACATCTGTATATTCCTGACTTCAGCACAAGGATTGAAGCAGCATTACTTGAGAACTCTGCAAAACTTTATAATTTGGAAACCCTTTCCACTCTATATTTCTCTCGTGTTGAGGATGCAGAATTGATGCTGAGAAAAACACCTAATCTTCGAAAACTGATATGTGAAGTTGAATGTTTAGAATACCCCCCTCAGTACCATGTGTTGAATTTTCCAATACGGCTTGAAATACTAAAGCTTTATCGATCAAAATTTAAAACCATCCCCTTTTGCATCTCTGCACCAAATCTCAAATACTTGAAACTCTGTGGCTTTTCCCTGGATTCTCAGTACTTATCAGAAACTGCTGATCATCTCAAGCACCTTGAGGTACTCATACTGTACAAGGTTGAATTTGGTGATCATAGGGAATGGAAAGTGAGCAATGGCAAGTTCCCTCAACTCAAAATCTTGAAACTAGAATATTTGTCCTTGGTGAAATGGATTGTAGCTGATGATGCCTTTCCTAACCTTGAACAATTGGTTTTGCGTGGATGTCAAGATCTTATGGAGATCCCTTCTTGTTTCATGGACATCCTTTCTCTCAAGTACATCGGGGTAGAATACTGCAATGAGTCGGTTGTCAAGTCAGCCTTGAATATACAAGAAACACAAGTCGAAGATTATCAAAATACTAATTTCAAGCTCGTTCTCATCGAGTTTTCTTTGCAGAAAAAGGCGTGGAAATTAAATTTAACTGATGCGGAAGATATGCACAATGCAGTAAAAAATATTCTTGCAGAAATAAGATAG


Protein sequences

Name Description Sequence
late blight resistance protein late blight resistance protein [Solanum demissum].

MNFNNELSDLKNRFLFRTLRAQKCSDVARDRIDFFIWELKFLNCFLHLQSFAFASECGMLDISQKMIEICKRFNTPPPHNSFAYWKEVICKRLCAISIQPDASSDDGFACWKKVIWKTKQEFRAKYSFPKTLLADNKVYDDDDTNPKFVMEFIDAVVGNLNVLVKINDPSSLLFVPGPKEQIEQVLKELKLLRFFVCFVSNKCIEPQYQHTTFYTHALIEASHIAMVVWLNLPIYGNRNQDLASSEVSCLLSDFMEMKIKSIQPDISRNNIYIDVLRALKSTIPQAQDKHAAESGIVETPTHNLMVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGQKEDTTLEDINQALGFDLPRNIEPIKAMINLVMQKAFQCNLPRIHGLGYVDFLLKNLKDFQGRYSDSLDFLKNQLQVIQTEFESLQPFLKVVVEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEVPQWCIERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLNGTKGQDVISIHGMPGLGKTTLANSLYSDRSVFSQFDICAQCCVSQVYSYKDLILALLRDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEVESWKLLEKKVFGEESCSPLLKNVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGSYIHNDSRAIVDKSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRRLEDIAEGYLENLIGRNLVMVTQRSISDGKAKECRLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHKQHAHLAFTEMHNLVEWSASCSFVGSVVLSNKYDSYFSTRDISSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELVYLKYFSAHIEQNSIPSSISNLWNLETLILKSPIYALRCTLLLPSTVWDMVKLRHLYIPDFSTRIEAALLENSAKLYNLETLSTLYFSRVEDAELMLRKTPNLRKLICEVECLEYPPQYHVLNFPIRLEILKLYRSKFKTIPFCISAPNLKYLKLCGFSLDSQYLSETADHLKHLEVLILYKVEFGDHREWKVSNGKFPQLKILKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVKSALNIQETQVEDYQNTNFKLVLIEFSLQKKAWKLNLTDAEDMHNAVKNILAEIR

Domains

Domain Start-End Description Sequence

HMMPfam: PF12061
IPR021929
111-515 DUF3542
Late blight resistance protein R1

WKKVIWKTKQEFRAKYSFPKTLLADNKVYDDDDTNPKFVMEFIDAVVGNLNVLVKINDPSSLLFVPGPKEQIEQVLKELKLLRFFVCFVSNKCIEPQYQHTTFYTHALIEASHIAMVVWLNLPIYGNRNQDLASSEVSCLLSDFMEMKIKSIQPDISRNNIYIDVLRALKSTIPQAQDKHAAESGIVETPTHNLMVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGQKEDTTLEDINQALGFDLPRNIEPIKAMINLVMQKAFQCNLPRIHGLGYVDFLLKNLKDFQGRYSDSLDFLKNQLQVIQTEFESLQPFLKVVVEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEVPQWCIERWLLDIIEEITCIKAKIQE

HMMPanther: PTHR11017
393-886 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MQKAFQCNLPRIHGLGYVDFLLKNLKDFQGRYSDSLDFLKNQLQVIQTEFESLQPFLKVVVEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEVPQWCIERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLNGTKGQDVISIHGMPGLGKTTLANSLYSDRSVFSQFDICAQCCVSQVYSYKDLILALLRDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEVESWKLLEKKVFGEESCSPLLKNVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGSYIHNDSRAIVDKSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRRLEDIAEGYLENLIGRNLVMVTQRSISDGKAKECRLHDVLLDFCKERAAEENFLLWINR

HMMPanther: PTHR11017:SF126
393-886 PTHR11017:SF126,OS11G0237600 PROTEIN

MQKAFQCNLPRIHGLGYVDFLLKNLKDFQGRYSDSLDFLKNQLQVIQTEFESLQPFLKVVVEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEVPQWCIERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLNGTKGQDVISIHGMPGLGKTTLANSLYSDRSVFSQFDICAQCCVSQVYSYKDLILALLRDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEVESWKLLEKKVFGEESCSPLLKNVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGSYIHNDSRAIVDKSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRRLEDIAEGYLENLIGRNLVMVTQRSISDGKAKECRLHDVLLDFCKERAAEENFLLWINR

superfamily: SSF52540
526-774 SSF52540

VIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLNGTKGQDVISIHGMPGLGKTTLANSLYSDRSVFSQFDICAQCCVSQVYSYKDLILALLRDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEVESWKLLEKKVFGEESCSPLLKNVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGSYIHND

Gene3D: G3DSA:3.40.50.300
538-695 G3DSA:3.40.50.300

PRMNEEIVGFEDVIENLRKKLLNGTKGQDVISIHGMPGLGKTTLANSLYSDRSVFSQFDICAQCCVSQVYSYKDLILALLRDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSD

HMMPfam: PF00931
IPR002182
548-825 NB-ARC,NBS
NB-ARC

EDVIENLRKKLLNGTKGQDVISIHGMPGLGKTTLANSLYSDRSVFSQFDICAQCCVSQVYSYKDLILALLRDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEVESWKLLEKKVFGEESCSPLLKNVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGSYIHNDSRAIVDKSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSE

FPrintScan: PR00364
IPR000767
567-582 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
642-656 DISEASERSIST
Disease resistance protein

TLLPRRYLILVDDVW

FPrintScan: PR00364
IPR000767
736-750 DISEASERSIST
Disease resistance protein

CGQLPLSIVLVAGIL

superfamily: SSF52058
862-1239 SSF52058,LRR

RLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHKQHAHLAFTEMHNLVEWSASCSFVGSVVLSNKYDSYFSTRDISSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELVYLKYFSAHIEQNSIPSSISNLWNLETLILKSPIYALRCTLLLPSTVWDMVKLRHLYIPDFSTRIEAALLENSAKLYNLETLSTLYFSRVEDAELMLRKTPNLRKLICEVECLEYPPQYHVLNFPIRLEILKLYRSKFKTIPFCISAPNLKYLKLCGFSLDSQYLSETADHLKHLEVLILYKVEFGDHREWKVSNGKFPQLKILKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVK

Gene3D: G3DSA:3.80.10.10
945-1083 G3DSA:3.80.10.10

HDFSISRILPNFKFLKVLDLEHRVFIDFIPTELVYLKYFSAHIEQNSIPSSISNLWNLETLILKSPIYALRCTLLLPSTVWDMVKLRHLYIPDFSTRIEAALLENSAKLYNLETLSTLYFSRVEDAELMLRKTPNLRKL

Gene3D: G3DSA:3.80.10.10
1104-1234 G3DSA:3.80.10.10

RLEILKLYRSKFKTIPFCISAPNLKYLKLCGFSLDSQYLSETADHLKHLEVLILYKVEFGDHREWKVSNGKFPQLKILKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCN

FPrintScan: PR00364
IPR000767
1196-1212 DISEASERSIST
Disease resistance protein

DAFPNLEQLVLRGCQDL


Diseases

Disease Pathogen Avirulence gene
Late Blight Tomato Phytophthora infestans

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox