PRGDB00000047 (R3a)

From PRG Wiki
Jump to: navigation, search
R3a
Gene Type Reference_R-Genes,_manually_curated
GenBank 57233496 (AY849382)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Chromosome 11
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum potato late blight resistance protein R3a gene, complete cds.

DNA Sequence

ATGGAGATTGGCTTAGCAGTTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTCACGGTGATCTGCTCAACATGTTTCAGAAGCATAAGGATCATGTTAAGCTCTTAAAGAAGCTGGAGGACATTTTGCTCGGTCTTCAGATTGTGCTAAGTGATGCAGAGAATAAACAAGCATCAAATCGACATGTGAGCCAGTGGTTCAATAAGCTTCAGAATGCTGTGGACGGTGCTGAGAACTTGATAGAACAAGTCAATTATGAAGCTTTGAGGCTTAAGGTGGAAGGCCAGCATCAAAATCTTGCAGAAACAAGCAACCAGCAAGTAAGTGACCTTAACCTGTGCTTCAGTGATGATTTCTTTCTTAACATAAAGGATAAGTTGGAAGAAACCATTGAAACATTGGAGGTGTTGGAAAAGCAAATTGGTCGCCTTGGCTTAAAGGAACATTTTGGTTCGACTAAACAAGAAACTAGAACACCTTCAACTTCTTTAGTTGATGACTCTGATATCTTTGGAAGGCAGAATGATATAGAGGATTTGATTGACCGTTTATTATCTGAAGATGCAAGTGGAAAAAAGCGGACTGTAGTTCCTATTGTTGGAATGGGTGGTCTGGGTAAGACAACACTTGCTAAAGCGGTTTACAATGATGAGAGAGTGCAGATACATTTTGGTTTGAAAGCTTGGTTTTGTGTTTCTGAGGCATTTGATGCTTTCAGAATAACAAAAGGGTTACTTCAAGAAATTGGCTCATTTGACTTGAAGGCTGATGACAATCTTAATCAGCTACAAGTCAAATTGAAGGAAAGATTAAAGGGAAAGAAGTTTCTTATAGTTTTGGATGATGTGTGGAATGACAACTACAACAAGTGGGATGAATTGAGAAATGTTTTTGTACAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGTAAAGAGAGTGTTGCCTTGATGATGGGAAATGAGCAAATTAGCATGGACAATTTGTCTACTGAATCCTCTTGGTCTTTATTTAAAACACATGCATTTGAAAACATGGGTCCTATGGGACATCCGGAACTTGAAGAGGTCGGGAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATATTACCAGCGTTGATGTTGAGCTACAATGATCTTCCCGCACATTTAAAGCGATGTTTTTCCTTTTGTGCAATATTTCCTAAAGATTATCCCTTTAGGAAAGAACAAGTTATTCATCTGTGGATTGCCAATGGTCTCGTACCACAGGAAGATGTAATAATTGAAGATTCAGGCAACCAATACTTTCTCGAGTTGAGGTCAAGATCATTATTCGAAAGGGTCCCAAATCCTTCTCAAGGGAACACAGAGAATTTATTCTTAATGCATGACCTTGTCAATGATTTAGCGCAAATTGCATCTTCAAAACTTTGTATCAGGTTGGAAGAGAGCCAAGGATCTCATATGTTGGAACAAAGTCAACACTTATCATATTCAATGGGATATGGTGGTGAGTTTGAGAAATTGACACCCCTCTACAAATTGGAGCAGCTGAGGACATTGCTTCCGACATGTATTGATCTCCCTGATTGTTGTCACCATCTAAGCAAGAGGGTGCTACATAACATACTGCCAAGACTAACATCCTTAAGGGCATTATCGTTGTCATGCTATGAGATTGTTGAGTTGCCAAATGACTTGTTTATCAAATTAAAGCTCCTCAGATTTTTGGATATTTCTCGGACAGAGATTAAAAGGTTGCCAGATTCCATTTGTGCATTGTATAACTTAGAGACACTTCTCCTGTCATCTTGTTATGATCTTGAGGAGCTACCGCTGCAGATGGAGAAGCTGATTAACTTGCGTCATCTTGACATAAGCAACACTCGTCTCTTGAAGATGCCGCTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGTTAGTGGGAGCCAAATTTCTTATAGGTGGTTTGAGAATGGAAGATTTGGGTGAAGTACATAACTTGTACGGATCTCTATCAGTTGTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCACGTCGACAGGTTATATTTGGAGTGGAGTGGAAGTAGTAGTGCCGACAATTCACAAACAGAAAGAGACATACTTGATGAGCTACGCCCCCATAAAAACATAAAAGTAGTCAAAATCACTGGATATAGAGGGACAAACTTTCCCAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTGGTAAAATTGTCTCTTAGAAACTGCAAGAACTGTTATTCATTGCCAGCACTAGGACAACTCCCTTTTCTGAAATTCCTTTCGATTAGAGAGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATGGCAGTTGGTCCTCCAAAAAGCCTTTTAACTGTCTTGAGAAGCTTGAATTTAAAGATATGCCGGAGTGGAAGCAATGGGACCTACTAGGAAGTGGAGAGTTCCCTATACTTGAGAAGCTTTTGATTGAAAATTGCCCTGAACTCAGTTTGGAGACGGTACCCATCCAACTTTCAAGTTTAAAAAGTTTTGACGTAATTGGTTCTCCCTTGGTTATAAACTTTCCTTTAAGCATACTGCCCACTACCTTGAAGAGAATAAAGATATCTGATTGCCAGAAATTGAAATTGGAACAGCCAACTGGTGAGATTAGTATGTTTCTGGAGGAATTGACACTGATTAAATGTGATTGTATAGATGATATATCACCTGAGTTACTCCCAAGAGCACGCAAATTGTGGGTACAGGATTGGCACAACCTTACTAGGTTTTTGATTCCTACTGCCACTGAAACTCTCGATATTTGGAATTGTGAGAATGTTGAAATACTTTCGGTGGCATGTGGGGGGACCCAGATGACGTCACTGACTATTGCCTACTGTAAGAAGCTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAAGGAACTGCATCTGTCTAATTGTCCAGAAATAGAGTCCTTTCCTGAAGGTGGATTGCCCTTCAATTTACAACAACTTGCGATCAGATATTGCAAGAAACTGGTGAACGGCCGAAAGGAGTGGCATTTACAGAGACGACTCTGTCTCACAGCGTTAATCATCTACCATGATGGCAGTGACGAAGAGATTGTTGGTGGTGAGAATTGGGAGTTGCCTTCCTCTATTCAAAGGCTTACCATAGTGAATCTGAAAACATTAAGCAGCCAACATCTCAAAAACCTCACCTCTCTTCAATATCTATTTATTAGGGGTAATTTACCTCAGATTCAGCCAATGCTGGAACAAGGCCAGTGTTCGCACCTCACTTCGCTTCAAAGTCTACAAATCTCCTCCCTCCAATCACTTCCTGAATCGGCACTGCCCTCCTCCCTCTCTCACCTGGAGATCTCCCATTGCCCTAATCTCCAATCACTTCCTGAATCGGCACTGCCCTCCTCCCTCTCTCAGCTGACCATCAATAATTGCCCTAATCTCCAATCACTTTCCGAATCAACACTGCCCTCCTCCCTCTCTCAGCTGGAGATCTCCTTTTGCCCTAATCTCCAATATCTTCCACTAAAAGGGATGCCCTCTTCCCTCTCTGAACTATCTATTTACAAATGCCCATTGCTCAAACCACAACTAGAATTTGACAAGGGGGAATACTGGCCAAATATTGCTCAATTTCCCACCATAAAGATCGATAGGGAATGCATGTGA


Protein sequences

Name Description Sequence
potato late blight resistance protein R3a potato late blight resistance protein R3a [Solanum tuberosum].

MEIGLAVGGAFLSSALNVLFDRLAPHGDLLNMFQKHKDHVKLLKKLEDILLGLQIVLSDAENKQASNRHVSQWFNKLQNAVDGAENLIEQVNYEALRLKVEGQHQNLAETSNQQVSDLNLCFSDDFFLNIKDKLEETIETLEVLEKQIGRLGLKEHFGSTKQETRTPSTSLVDDSDIFGRQNDIEDLIDRLLSEDASGKKRTVVPIVGMGGLGKTTLAKAVYNDERVQIHFGLKAWFCVSEAFDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKERLKGKKFLIVLDDVWNDNYNKWDELRNVFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTESSWSLFKTHAFENMGPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPQEDVIIEDSGNQYFLELRSRSLFERVPNPSQGNTENLFLMHDLVNDLAQIASSKLCIRLEESQGSHMLEQSQHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCIDLPDCCHHLSKRVLHNILPRLTSLRALSLSCYEIVELPNDLFIKLKLLRFLDISRTEIKRLPDSICALYNLETLLLSSCYDLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLVGAKFLIGGLRMEDLGEVHNLYGSLSVVELQNVVDRREAVKAKMREKNHVDRLYLEWSGSSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLADPLFLKLVKLSLRNCKNCYSLPALGQLPFLKFLSIREMHGITEVTEEFYGSWSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKSFDVIGSPLVINFPLSILPTTLKRIKISDCQKLKLEQPTGEISMFLEELTLIKCDCIDDISPELLPRARKLWVQDWHNLTRFLIPTATETLDIWNCENVEILSVACGGTQMTSLTIAYCKKLKWLPERMQELLPSLKELHLSNCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRRLCLTALIIYHDGSDEEIVGGENWELPSSIQRLTIVNLKTLSSQHLKNLTSLQYLFIRGNLPQIQPMLEQGQCSHLTSLQSLQISSLQSLPESALPSSLSHLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLEISFCPNLQYLPLKGMPSSLSELSIYKCPLLKPQLEFDKGEYWPNIAQFPTIKIDRECM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
11-895 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPHGDLLNMFQKHKDHVKLLKKLEDILLGLQIVLSDAENKQASNRHVSQWFNKLQNAVDGAENLIEQVNYEALRLKVEGQHQNLAETSNQQVSDLNLCFSDDFFLNIKDKLEETIETLEVLEKQIGRLGLKEHFGSTKQETRTPSTSLVDDSDIFGRQNDIEDLIDRLLSEDASGKKRTVVPIVGMGGLGKTTLAKAVYNDERVQIHFGLKAWFCVSEAFDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKERLKGKKFLIVLDDVWNDNYNKWDELRNVFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTESSWSLFKTHAFENMGPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPQEDVIIEDSGNQYFLELRSRSLFERVPNPSQGNTENLFLMHDLVNDLAQIASSKLCIRLEESQGSHMLEQSQHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCIDLPDCCHHLSKRVLHNILPRLTSLRALSLSCYEIVELPNDLFIKLKLLRFLDISRTEIKRLPDSICALYNLETLLLSSCYDLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLVGAKFLIGGLRMEDLGEVHNLYGSLSVVELQNVVDRREAVKAKMREKNHVDRLYLEWSGSSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLADPLFLKLVKLSLRNCKNCYSLPALGQLPFLKFLSIREMHGITEVTEEFYGSWSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKS

HMMPanther: PTHR23155
11-895 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPHGDLLNMFQKHKDHVKLLKKLEDILLGLQIVLSDAENKQASNRHVSQWFNKLQNAVDGAENLIEQVNYEALRLKVEGQHQNLAETSNQQVSDLNLCFSDDFFLNIKDKLEETIETLEVLEKQIGRLGLKEHFGSTKQETRTPSTSLVDDSDIFGRQNDIEDLIDRLLSEDASGKKRTVVPIVGMGGLGKTTLAKAVYNDERVQIHFGLKAWFCVSEAFDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKERLKGKKFLIVLDDVWNDNYNKWDELRNVFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTESSWSLFKTHAFENMGPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPQEDVIIEDSGNQYFLELRSRSLFERVPNPSQGNTENLFLMHDLVNDLAQIASSKLCIRLEESQGSHMLEQSQHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCIDLPDCCHHLSKRVLHNILPRLTSLRALSLSCYEIVELPNDLFIKLKLLRFLDISRTEIKRLPDSICALYNLETLLLSSCYDLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLVGAKFLIGGLRMEDLGEVHNLYGSLSVVELQNVVDRREAVKAKMREKNHVDRLYLEWSGSSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLADPLFLKLVKLSLRNCKNCYSLPALGQLPFLKFLSIREMHGITEVTEEFYGSWSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKS

superfamily: SSF52540
160-410 SSF52540

TKQETRTPSTSLVDDSDIFGRQNDIEDLIDRLLSEDASGKKRTVVPIVGMGGLGKTTLAKAVYNDERVQIHFGLKAWFCVSEAFDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKERLKGKKFLIVLDDVWNDNYNKWDELRNVFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTESSWSLFKTHAFENMGPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

Gene3D: G3DSA:3.40.50.300
172-317 G3DSA:3.40.50.300

VDDSDIFGRQNDIEDLIDRLLSEDASGKKRTVVPIVGMGGLGKTTLAKAVYNDERVQIHFGLKAWFCVSEAFDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKERLKGKKFLIVLDDVWNDNYNKWDELRNVFVQGDIGSKIIVT

HMMPfam: PF00931
IPR002182
180-462 NB-ARC,NBS
NB-ARC

RQNDIEDLIDRLLSEDASGKKRTVVPIVGMGGLGKTTLAKAVYNDERVQIHFGLKAWFCVSEAFDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKERLKGKKFLIVLDDVWNDNYNKWDELRNVFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTESSWSLFKTHAFENMGPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPQED

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

RLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
498-971 SSF52058,LRR

LMHDLVNDLAQIASSKLCIRLEESQGSHMLEQSQHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCIDLPDCCHHLSKRVLHNILPRLTSLRALSLSCYEIVELPNDLFIKLKLLRFLDISRTEIKRLPDSICALYNLETLLLSSCYDLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLVGAKFLIGGLRMEDLGEVHNLYGSLSVVELQNVVDRREAVKAKMREKNHVDRLYLEWSGSSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLADPLFLKLVKLSLRNCKNCYSLPALGQLPFLKFLSIREMHGITEVTEEFYGSWSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKSFDVIGSPLVINFPLSILPTTLKRIKISDCQKLKLEQPTGEISMFLEELTLIKCDCIDDISPELLPRARKLWVQDWH

Gene3D: G3DSA:3.80.10.10
571-717 G3DSA:3.80.10.10

HLSKRVLHNILPRLTSLRALSLSCYEIVELPNDLFIKLKLLRFLDISRTEIKRLPDSICALYNLETLLLSSCYDLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLVGAKFLIGGLRMEDLGEVHNLYGSLSVVELQNV

FPrintScan: PR00364
IPR000767
653-669 DISEASERSIST
Disease resistance protein

EKLINLRHLDISNTRLL

Gene3D: G3DSA:3.80.10.10
775-874 G3DSA:3.80.10.10

RGTNFPNWLADPLFLKLVKLSLRNCKNCYSLPALGQLPFLKFLSIREMHGITEVTEEFYGSWSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLL

Gene3D: G3DSA:3.80.10.10
875-1063 G3DSA:3.80.10.10

IENCPELSLETVPIQLSSLKSFDVIGSPLVINFPLSILPTTLKRIKISDCQKLKLEQPTGEISMFLEELTLIKCDCIDDISPELLPRARKLWVQDWHNLTRFLIPTATETLDIWNCENVEILSVACGGTQMTSLTIAYCKKLKWLPERMQELLPSLKELHLSNCPEIESFPEGGLPFNLQQLAIRYCKK

superfamily: SSF52058
1003-1271 SSF52058,LRR

TQMTSLTIAYCKKLKWLPERMQELLPSLKELHLSNCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRRLCLTALIIYHDGSDEEIVGGENWELPSSIQRLTIVNLKTLSSQHLKNLTSLQYLFIRGNLPQIQPMLEQGQCSHLTSLQSLQISSLQSLPESALPSSLSHLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLEISFCPNLQYLPLKGMPSSLSELSIYKCPLLKPQLEFDKGEYWPNIAQ

HMMPfam: PF00560
IPR001611
1029-1049 LRR_1
Leucine-rich repeat

SLKELHLSNCPEIESFPEGGL

Gene3D: G3DSA:3.80.10.10
1103-1252 G3DSA:3.80.10.10

SSIQRLTIVNLKTLSSQHLKNLTSLQYLFIRGNLPQIQPMLEQGQCSHLTSLQSLQISSLQSLPESALPSSLSHLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLEISFCPNLQYLPLKGMPSSLSELSIYKCP

HMMPfam: PF00560
IPR001611
1173-1193 LRR_1
Leucine-rich repeat

SLSHLEISHCPNLQSLPESAL


Diseases

Disease Pathogen Avirulence gene
Late Blight Tomato Phytophthora infestans PRGAV00000038

List of References

Sanwen Huang, Edwin A G van der Vossen, Hanhui Kuang, Vivianne G A A Vleeshouwers, Ningwen Zhang, Theo J A Borm, Herman J van Eck, Barbara Baker, Evert Jacobsen, Richard G F Visser
Comparative genomics enabled the isolation of the R3a late blight resistance gene in potato.
Plant J.: 2005, 42(2);251-61
PubMed:15807786 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox