PRGDB00000048 (Rpi-blb1)

From PRG Wiki
Jump to: navigation, search
Rpi-blb1
Gene Type Reference_R-Genes,_manually_curated
GenBank 32693280 (AY336128)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Chromosome 8
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum putative disease resistant protein RGA2 gene, complete cds.

DNA Sequence

ATGGCTGAAGCTTTCATTCAAGTTCTGCTAGACAATCTCACTTCTTTCCTCAAAGGGGAACTTGTATTGCTTTTCGGTTTTCAAGATGAGTTCCAAAGGCTTTCAAGCATGTTTTCTACAATTCAAGCCGTCCTTGAAGATGCTCAGGAGAAGCAACTCAACAACAAGCCTCTAGAAAATTGGTTGCAAAAACTCAATGCTGCTACATATGAAGTCGATGACATCTTGGATGAATATAAAACCAAGGCCACAAGATTCTCCCAGTCTGAATATGGCCGTTATCATCCAAAGGTTATCCCTTTCCGTCACAAGGTCGGGAAAAGGATGGACCAAGTGATGAAAAAACTAAAGGCAATTGCTGAGGAAAGAAAGAATTTTCATTTGCACGAAAAAATTGTAGAGAGACAAGCTGTTAGACGGGAAACAGGTTCTGTATTAACCGAACCGCAGGTTTATGGAAGAGACAAAGAGAAAGATGAGATAGTGAAAATCCTAATAAACAATGTTAGTGATGCCCAACACCTTTCAGTCCTCCCAATACTTGGTATGGGGGGATTAGGAAAAACGACTCTTGCCCAAATGGTCTTCAATGACCAGAGAGTTACTGAGCATTTCCATTCCAAAATATGGATTTGTGTCTCGGAAGATTTTGATGAGAAGAGGTTAATAAAGGCAATTGTAGAATCTATTGAAGGAAGGCCACTACTTGGTGAGATGGACTTGGCTCCACTTCAAAAGAAGCTTCAGGAGTTGCTGAATGGAAAAAGATACTTGCTTGTCTTAGATGATGTTTGGAATGAAGATCAACAGAAGTGGGCTAATTTAAGAGCAGTCTTGAAGGTTGGAGCAAGTGGTGCTTCTGTTCTAACCACTACTCGTCTTGAAAAGGTTGGATCAATTATGGGAACATTGCAACCATATGAACTGTCAAATCTGTCTCAAGAAGATTGTTGGTTGTTGTTCATGCAACGTGCATTTGGACACCAAGAAGAAATAAATCCAAACCTTGTGGCAATCGGAAAGGAGATTGTGAAAAAAAGTGGTGGTGTGCCTCTAGCAGCCAAAACTCTTGGAGGTATTTTGTGCTTCAAGAGAGAAGAAAGAGCATGGGAACATGTGAGAGACAGTCCGATTTGGAATTTGCCTCAAGATGAAAGTTCTATTCTGCCTGCCCTGAGGCTTAGTTACCATCAACTTCCACTTGATTTGAAACAATGCTTTGCGTATTGTGCGGTGTTCCCAAAGGATGCCAAAATGGAAAAAGAAAAGCTAATCTCTCTCTGGATGGCGCATGGTTTTCTTTTATCAAAAGGAAACATGGAGCTAGAGGATGTGGGCGATGAAGTATGGAAAGAATTATACTTGAGGTCTTTTTTCCAAGAGATTGAAGTTAAAGATGGTAAAACTTATTTCAAGATGCATGATCTCATCCATGATTTGGCAACATCTCTGTTTTCAGCAAACACATCAAGCAGCAATATCCGTGAAATAAATAAACACAGTTACACACATATGATGTCCATTGGTTTCGCCGAAGTGGTGTTTTTTTACACTCTTCCCCCCTTGGAAAAGTTTATCTCGTTAAGAGTGCTTAATCTAGGTGATTCGACATTTAATAAGTTACCATCTTCCATTGGAGATCTAGTACATTTAAGATACTTGAACCTGTATGGCAGTGGCATGCGTAGTCTTCCAAAGCAGTTATGCAAGCTTCAAAATCTGCAAACTCTTGATCTACAATATTGCACCAAGCTTTGTTGTTTGCCAAAAGAAACAAGTAAACTTGGTAGTCTCCGAAATCTTTTACTTGATGGTAGCCAGTCATTGACTTGTATGCCACCAAGGATAGGATCATTGACATGCCTTAAGACTCTAGGTCAATTTGTTGTTGGAAGGAAGAAAGGTTATCAACTTGGTGAACTAGGAAACCTAAATCTCTATGGCTCAATTAAAATCTCGCATCTTGAGAGAGTGAAGAATGATAAGGACGCAAAAGAAGCCAATTTATCTGCAAAAGGGAATCTGCATTCTTTAAGCATGAGTTGGAATAACTTTGGACCACATATATATGAATCAGAAGAAGTTAAAGTGCTTGAAGCCCTCAAACCACACTCCAATCTGACTTCTTTAAAAATCTATGGCTTCAGAGGAATCCATCTCCCAGAGTGGATGAATCACTCAGTATTGAAAAATATTGTCTCTATTCTAATTAGCAACTTCAGAAACTGCTCATGCTTACCACCCTTTGGTGATCTGCCTTGTCTAGAAAGTCTAGAGTTACACTGGGGGTCTGCGGATGTGGAGTATGTTGAAGAAGTGGATATTGATGTTCATTCTGGATTCCCCACAAGAATAAGGTTTCCATCCTTGAGGAAACTTGATATATGGGACTTTGGTAGTCTGAAAGGATTGCTGAAAAAGGAAGGAGAAGAGCAATTCCCTGTGCTTGAAGAGATGATAATTCACGAGTGCCCTTTTCTGACCCTTTCTTCTAATCTTAGGGCTCTTACTTCCCTCAGAATTTGCTATAATAAAGTAGCTACTTCATTCCCAGAAGAGATGTTCAAAAACCTTGCAAATCTCAAATACTTGACAATCTCTCGGTGCAATAATCTCAAAGAGCTGCCTACCAGCTTGGCTAGTCTGAATGCTTTGAAAAGTCTAAAAATTCAATTGTGTTGCGCACTAGAGAGTCTCCCTGAGGAAGGGCTGGAAGGTTTATCTTCACTCACAGAGTTATTTGTTGAACACTGTAACATGCTAAAATGTTTACCAGAGGGATTGCAGCACCTAACAACCCTCACAAGTTTAAAAATTCGGGGATGTCCACAACTGATCAAGCGGTGTGAGAAGGGAATAGGAGAAGACTGGCACAAAATTTCTCACATTCCTAATGTGAATATATATATTTAA


Protein sequences

Name Description Sequence
putative disease resistant protein RGA2 putative disease resistant protein RGA2 [Solanum bulbocastanum].

MAEAFIQVLLDNLTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNNKPLENWLQKLNAATYEVDDILDEYKTKATRFSQSEYGRYHPKVIPFRHKVGKRMDQVMKKLKAIAEERKNFHLHEKIVERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEVWKELYLRSFFQEIEVKDGKTYFKMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLCCALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHIPNVNIYI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-947 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNNKPLENWLQKLNAATYEVDDILDEYKTKATRFSQSEYGRYHPKVIPFRHKVGKRMDQVMKKLKAIAEERKNFHLHEKIVERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEVWKELYLRSFFQEIEVKDGKTYFKMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLCCALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIK

superfamily: SSF52540
134-384 SSF52540

ERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQD

Gene3D: G3DSA:3.40.50.300
153-293 G3DSA:3.40.50.300

GRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTR

HMMPfam: PF00931
IPR002182
155-434 NB-ARC,NBS
NB-ARC

DKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

VLPILGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

LLNGKRYLLVLDDVW

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

SGGVPLAAKTLGGIL

superfamily: SSF52058
472-830 SSF52058,LRR

KMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLS

Gene3D: G3DSA:3.80.10.10
481-625 G3DSA:3.80.10.10

ATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTL

FPrintScan: PR00364
IPR000767
569-585 DISEASERSIST
Disease resistance protein

CKLQNLQTLDLQYCTKL

HMMPfam: PF00560
IPR001611
573-591 LRR_1
Leucine-rich repeat

NLQTLDLQYCTKLCCLPKE

Gene3D: G3DSA:3.80.10.10
706-762 G3DSA:3.80.10.10

NLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHW

Gene3D: G3DSA:3.80.10.10
779-948 G3DSA:3.80.10.10

SGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLCCALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKR

superfamily: SSF52058
781-945 SSF52058,LRR

FPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLCCALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQL

HMMPfam: PF13855
860-919 LRR_8,Leucine rich repeat

NLKYLTISRCNNLKELPTSLASLNALKSLKIQLCCALESLPEEGLEGLSSLTELFVEHCN


Diseases

Disease Pathogen Avirulence gene
Late Blight Tomato Phytophthora infestans




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox