PRGDB00000049 (Rpi-blb2)

From PRG Wiki
Jump to: navigation, search
Rpi-blb2
Gene Type Reference_R-Genes,_manually_curated
GenBank 74040323 (DQ122125)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 4
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum late blight resistance protein Rpi-blb2 (Rpi-blb2) gene, complete cds.

DNA Sequence

ATGGAAAAACGAAAAGATAATGAAGAAGCAAACAACTCATTGGAGTCATTTTCTGCTCTTCGCAAGGATGCTGCCAATGTTCTGGATTTCCTAGAGAGATTAAAGAATGAAGAAGATCAAAAGGCTGTTGATGTGGATCTGATTGAAAGCCTGAAATTGAAGCTGACATTTATTTGTACATATGTCCAGCTTTCTTATTCCGATTTGGAGAAGTTTGAAGATATAATGACTAGAAAAAGACAAGAGGTTGAGAATCTGCTTCAACCAATTTTGGATGATGATGGCAAAGACGTCGGGTGTAAATATGTCCTTACTAGCCTCGCCGGTAATATGGATGACTGTATAAGCTTGTATCATCGTTCTAAATCAGATGCCACCATGATGGATGAGCAATTGGGCTTCCTCCTCTTGAATCTCTCTCATCTATCCAAGCATCGTGCTGAAAAGATGTTTCCTGGAGTGACTCAATATGAGGTTCTTCAGAATGTATGTGGCAACATAAGAGATTTCCATGGATTGATAGTGAATTGTTGCATTAAGCATGAGATGGTTGAGAATGTCTTATCTCTGTTTCAACTGATGGCTGAGAGAGTAGGACGCTTCCTTTGGGAGGATCAGGCTGATGAAGACTCTCAACTCTCCGAGCTAGATGAGGATGATCAGAATGATAAAGACCCTCAACTCTTCAAGCTAGCACATCTACTCTTGAAGATTGTTCCAACTGAATTGGAGGTTATGCACATATGTTATAAAACTTTGAAAGCTTCAACTTCAACAGAAATTGGACGCTTCATTAAGAAGCTCCTGGAAACCTCTCCGGACATTCTCAGAGAATATCTGATTCATCTACAAGAGCATATGATAACTGTTATTACCCCTAACACTTCAGGGGCTCGAAACATTCATGTCATGATGGAATTCCTATTGATTATTCTTTCTGATATGCCGCCCAAGGACTTTATTCATCATGACAAACTTTTTGATCTCTTGGCTCGTGTTGTAGCACTTACCAGGGAGGTATCAACTCTTGTACGCGACTTGGAAGAGAAATTAAGGATTAAAGAGAGTACTGACGAAACAAATTGTGCAACCCTAAAGTTTCTGGAAAATATTGAACTCCTTAAGGAAGATCTCAAACATGTTTATCTGAAAGTCCCGGATTCATCTCAATATTGCTTCCCCATGAGTGATGGACCTCTCTTCATGCATCTGCTACAGAGACACTTAGATGATTTGCTGGATTCCAATGCTTATTCAATTGCTTTGATAAAGGAACAAATTGGGCTGGTGAAAGAAGACTTGGAATTCATAAGATCTTTTTTCGCGAATATTGAGCAAGGATTGTATAAAGATCTCTGGGAACGTGTTCTAGATGTGGCATATGAGGCAAAAGATGTCATAGATTCAATTATTGTTCGAGATAATGGTCTCTTACATCTTATTTTCTCACTTCCCATTACCAGAAAGAAGATGATGCTTATCAAAGAAGAGGTCTCTGATTTACATGAGAACATTTCCAAGAACAGAGGTCTCATCGTTGTGAACTCTCCCAAGAAACCAGTTGAGAGCAAGTCATTGACAACTGATAAAATAATTGTAGGTTTTGGTGAGGAGACAAACTTGATACTTAGAAAGCTCACCAGTGGACCGGCAGATCTAGATGTCATTTCGATCATTGGTATGCCGGGTTTAGGTAAAACTACTTTGGCGTACAAAGTATACAATGATAAATCAGTTTCTAGCCATTTCGACCTTCGTGCATGGTGCACGGTCGACCAAGTATATGACGAGAAGAAGTTGTTGGATAAAATTTTCAATCAAGTTAGTGACTCAAATTCAAAATTGAGTGAGAATATTGATGTTGCTGATAAACTACGGAAACAATTGTTTGGAAAGAGGTATCTTATTGTCTTAGATGACGTGTGGGATACTAATACATGGGATGAGCTAACAAGACCTTTTCCTGATGGTATGAAAGGAAGTAGAATTATTTTGACAACTCGAGAAAAGAAAGTTGCTTTGCATGGAAAGCTCTACACTGATCCTCTTAACCTTCGATTGCTAAGATCAGAAGAAAGTTGGGAGTTATTAGAGAAAAGGGCATTTGGAAACGAGAGTTGCCCTGATGAACTATTGGATGTTGGTAAAGAAATAGCCGAAAATTGTAAAGGGCTTCCTTTGGTGGTGGATCTGATTGCTGGAATCATTGCTGGGAGGGAAAAGAAAAAGAGTGTGTGGCTTGAAGTTGTAAATAATTTGCATTCCTTTATTTTGAAGAATGAAGTGGAAGTGATGAAAGTTATAGAAATAAGTTATGACCACTTACCTGATCACCTGAAGCCATGCTTGCTGTACTTTGCAAGTGCGCCGAAGGACTGGGTAACGACAATCCATGAGTTGAAACTTATTTGGGGTTTTGAAGGATTTGTGGAAAAGACAGATATGAAGAGTCTGGAAGAAGTGGTGAAAATTTATTTGGATGATTTAATTTCCAGTAGCTTGGTAATTTGTTTCAATGAGATAGGTGATTACCCTACTTGCCAACTTCATGATCTTGTGCATGACTTTTGTTTGATAAAAGCAAGAAAGGAAAAGTTGTGTGATCGGATAAGTTCAAGTGCTCCATCAGATTTGTTGCCACGTCAAATTAGCATTGATTATGATGATGATGAAGAGCACTTTGGGCTTAATTTTGTCCTGTTCGGTTCAAATAAGAAAAGGCATTCCGGTAAACACCTCTATTCTTTGACCATAAATGGAGATGAGCTGGACGACCATCTTTCTGATACATTTCATCTAAGACACTTGAGGCTTCTTAGAACCTTGCACCTGGAATCCTCTTTTATCATGGTTAAAGATTCTTTGCTGAATGAAATATGCATGTTGAATCATTTGAGGTACTTAAGCATTGGGACAGAAGTTAAATCTCTGCCTTTGTCTTTCTCAAACCTCTGGAATCTAGAAATCTTGTTTGTGGATAACAAAGAATCAACCTTGATACTATTACCGAGAATTTGGGATCTTGTAAAGTTGCAAGTGCTGTTCACGACTGCTTGTTCTTTCTTTGATATGGATGCAGATGAATCAATACTGATAGCAGAGGACACAAAGTTAGAGAACTTGACAGCATTAGGGGAACTCGTGCTTTCCTATTGGAAAGATACAGAGGATATTTTCAAAAGGCTTCCCAATCTTCAAGTGCTTCATTTCAAACTCAAGGAGTCATGGGATTATTCAACAGAGCAATATTGGTTCCCGAAATTGGATTTCCTAACTGAACTAGAAAAACTCACTGTAGATTTTGAAAGATCAAACACAAATGACAGTGGGTCCTCTGCAGCCATAAATCGGCCATGGGATTTTCACTTTCCTTCGAGTTTGAAAAGATTGCAATTGCATGAATTTCCTCTGACATCCGATTCACTATCAACAATAGCGAGACTGCTGAACCTTGAAGAGTTGTACCTTTATCGTACAATCATCCATGGGGAAGAATGGAACATGGGAGAAGAAGACACCTTTGAGAATCTCAAATGTTTGATGTTGAGTCAAGTGATTCTTTCCAAGTGGGAGGTTGGAGAGGAATCTTTTCCCACGCTTGAGAAATTAGAACTGTCGGACTGTCATAATCTTGAGGAGATTCCGTCTAGTTTTGGGGATATTTATTCCTTGAAAATTATCGAACTTGTAAGGAGCCCTCAACTTGAAAATTCCGCTCTCAAGATTAAGGAATATGCTGAAGATATGAGGGGAGGGGACGAGCTTCAGATCCTTGGCCAGAAGGATATCCCGTTATTTAAGTAG


Protein sequences

Name Description Sequence
late blight resistance protein Rpi-blb2 late blight resistance protein Rpi-blb2 [Solanum bulbocastanum].

MEKRKDNEEANNSLESFSALRKDAANVLDFLERLKNEEDQKAVDVDLIESLKLKLTFICTYVQLSYSDLEKFEDIMTRKRQEVENLLQPILDDDGKDVGCKYVLTSLAGNMDDCISLYHRSKSDATMMDEQLGFLLLNLSHLSKHRAEKMFPGVTQYEVLQNVCGNIRDFHGLIVNCCIKHEMVENVLSLFQLMAERVGRFLWEDQADEDSQLSELDEDDQNDKDPQLFKLAHLLLKIVPTELEVMHICYKTLKASTSTEIGRFIKKLLETSPDILREYLIHLQEHMITVITPNTSGARNIHVMMEFLLIILSDMPPKDFIHHDKLFDLLARVVALTREVSTLVRDLEEKLRIKESTDETNCATLKFLENIELLKEDLKHVYLKVPDSSQYCFPMSDGPLFMHLLQRHLDDLLDSNAYSIALIKEQIGLVKEDLEFIRSFFANIEQGLYKDLWERVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITRKKMMLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTDMKSLEEVVKIYLDDLISSSLVICFNEIGDYPTCQLHDLVHDFCLIKARKEKLCDRISSSAPSDLLPRQISIDYDDDEEHFGLNFVLFGSNKKRHSGKHLYSLTINGDELDDHLSDTFHLRHLRLLRTLHLESSFIMVKDSLLNEICMLNHLRYLSIGTEVKSLPLSFSNLWNLEILFVDNKESTLILLPRIWDLVKLQVLFTTACSFFDMDADESILIAEDTKLENLTALGELVLSYWKDTEDIFKRLPNLQVLHFKLKESWDYSTEQYWFPKLDFLTELEKLTVDFERSNTNDSGSSAAINRPWDFHFPSSLKRLQLHEFPLTSDSLSTIARLLNLEELYLYRTIIHGEEWNMGEEDTFENLKCLMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELVRSPQLENSALKIKEYAEDMRGGDELQILGQKDIPLFK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
381-864 PTHR11017:SF126,OS11G0237600 PROTEIN

VYLKVPDSSQYCFPMSDGPLFMHLLQRHLDDLLDSNAYSIALIKEQIGLVKEDLEFIRSFFANIEQGLYKDLWERVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITRKKMMLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTDMKSLEEVVKIYLDDLISSSLVICFNEIGDYPTCQLHDLVHDFCLIKARKE

HMMPanther: PTHR11017
381-864 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VYLKVPDSSQYCFPMSDGPLFMHLLQRHLDDLLDSNAYSIALIKEQIGLVKEDLEFIRSFFANIEQGLYKDLWERVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITRKKMMLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTDMKSLEEVVKIYLDDLISSSLVICFNEIGDYPTCQLHDLVHDFCLIKARKE

superfamily: SSF52540
513-760 SSF52540

VVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKN

HMMPfam: PF00931
IPR002182
540-814 NB-ARC,NBS
NB-ARC

NLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTD

Gene3D: G3DSA:3.40.50.300
553-671 G3DSA:3.40.50.300

LDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKK

FPrintScan: PR00364
IPR000767
555-570 DISEASERSIST
Disease resistance protein

VISIIGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
628-642 DISEASERSIST
Disease resistance protein

QLFGKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
722-736 DISEASERSIST
Disease resistance protein

CKGLPLVVDLIAGII

superfamily: SSF52058
848-1231 SSF52058,LRR

QLHDLVHDFCLIKARKEKLCDRISSSAPSDLLPRQISIDYDDDEEHFGLNFVLFGSNKKRHSGKHLYSLTINGDELDDHLSDTFHLRHLRLLRTLHLESSFIMVKDSLLNEICMLNHLRYLSIGTEVKSLPLSFSNLWNLEILFVDNKESTLILLPRIWDLVKLQVLFTTACSFFDMDADESILIAEDTKLENLTALGELVLSYWKDTEDIFKRLPNLQVLHFKLKESWDYSTEQYWFPKLDFLTELEKLTVDFERSNTNDSGSSAAINRPWDFHFPSSLKRLQLHEFPLTSDSLSTIARLLNLEELYLYRTIIHGEEWNMGEEDTFENLKCLMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELVR

Gene3D: G3DSA:3.80.10.10
911-1101 G3DSA:3.80.10.10

KHLYSLTINGDELDDHLSDTFHLRHLRLLRTLHLESSFIMVKDSLLNEICMLNHLRYLSIGTEVKSLPLSFSNLWNLEILFVDNKESTLILLPRIWDLVKLQVLFTTACSFFDMDADESILIAEDTKLENLTALGELVLSYWKDTEDIFKRLPNLQVLHFKLKESWDYSTEQYWFPKLDFLTELEKLTVDF

Gene3D: G3DSA:3.80.10.10
1118-1230 G3DSA:3.80.10.10

PWDFHFPSSLKRLQLHEFPLTSDSLSTIARLLNLEELYLYRTIIHGEEWNMGEEDTFENLKCLMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELV

FPrintScan: PR00364
IPR000767
1195-1211 DISEASERSIST
Disease resistance protein

ESFPTLEKLELSDCHNL


Diseases

Disease Pathogen Avirulence gene
Late Blight Tomato Phytophthora infestans

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox