PRGDB00000049 (Rpi-blb2)

From PRG Wiki
Jump to: navigation, search
Rpi-blb2
Gene Type Reference_R-Genes,_manually_curated
GenBank 74040323 (DQ122125)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 4
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum late blight resistance protein Rpi-blb2 (Rpi-blb2) gene, complete cds.

DNA Sequence

ATGGAAAAACGAAAAGATAATGAAGAAGCAAACAACTCATTGGAGTCATTTTCTGCTCTTCGCAAGGATGCTGCCAATGTTCTGGATTTCCTAGAGAGATTAAAGAATGAAGAAGATCAAAAGGCTGTTGATGTGGATCTGATTGAAAGCCTGAAATTGAAGCTGACATTTATTTGTACATATGTCCAGCTTTCTTATTCCGATTTGGAGAAGTTTGAAGATATAATGACTAGAAAAAGACAAGAGGTTGAGAATCTGCTTCAACCAATTTTGGATGATGATGGCAAAGACGTCGGGTGTAAATATGTCCTTACTAGCCTCGCCGGTAATATGGATGACTGTATAAGCTTGTATCATCGTTCTAAATCAGATGCCACCATGATGGATGAGCAATTGGGCTTCCTCCTCTTGAATCTCTCTCATCTATCCAAGCATCGTGCTGAAAAGATGTTTCCTGGAGTGACTCAATATGAGGTTCTTCAGAATGTATGTGGCAACATAAGAGATTTCCATGGATTGATAGTGAATTGTTGCATTAAGCATGAGATGGTTGAGAATGTCTTATCTCTGTTTCAACTGATGGCTGAGAGAGTAGGACGCTTCCTTTGGGAGGATCAGGCTGATGAAGACTCTCAACTCTCCGAGCTAGATGAGGATGATCAGAATGATAAAGACCCTCAACTCTTCAAGCTAGCACATCTACTCTTGAAGATTGTTCCAACTGAATTGGAGGTTATGCACATATGTTATAAAACTTTGAAAGCTTCAACTTCAACAGAAATTGGACGCTTCATTAAGAAGCTCCTGGAAACCTCTCCGGACATTCTCAGAGAATATCTGATTCATCTACAAGAGCATATGATAACTGTTATTACCCCTAACACTTCAGGGGCTCGAAACATTCATGTCATGATGGAATTCCTATTGATTATTCTTTCTGATATGCCGCCCAAGGACTTTATTCATCATGACAAACTTTTTGATCTCTTGGCTCGTGTTGTAGCACTTACCAGGGAGGTATCAACTCTTGTACGCGACTTGGAAGAGAAATTAAGGATTAAAGAGAGTACTGACGAAACAAATTGTGCAACCCTAAAGTTTCTGGAAAATATTGAACTCCTTAAGGAAGATCTCAAACATGTTTATCTGAAAGTCCCGGATTCATCTCAATATTGCTTCCCCATGAGTGATGGACCTCTCTTCATGCATCTGCTACAGAGACACTTAGATGATTTGCTGGATTCCAATGCTTATTCAATTGCTTTGATAAAGGAACAAATTGGGCTGGTGAAAGAAGACTTGGAATTCATAAGATCTTTTTTCGCGAATATTGAGCAAGGATTGTATAAAGATCTCTGGGAACGTGTTCTAGATGTGGCATATGAGGCAAAAGATGTCATAGATTCAATTATTGTTCGAGATAATGGTCTCTTACATCTTATTTTCTCACTTCCCATTACCAGAAAGAAGATGATGCTTATCAAAGAAGAGGTCTCTGATTTACATGAGAACATTTCCAAGAACAGAGGTCTCATCGTTGTGAACTCTCCCAAGAAACCAGTTGAGAGCAAGTCATTGACAACTGATAAAATAATTGTAGGTTTTGGTGAGGAGACAAACTTGATACTTAGAAAGCTCACCAGTGGACCGGCAGATCTAGATGTCATTTCGATCATTGGTATGCCGGGTTTAGGTAAAACTACTTTGGCGTACAAAGTATACAATGATAAATCAGTTTCTAGCCATTTCGACCTTCGTGCATGGTGCACGGTCGACCAAGTATATGACGAGAAGAAGTTGTTGGATAAAATTTTCAATCAAGTTAGTGACTCAAATTCAAAATTGAGTGAGAATATTGATGTTGCTGATAAACTACGGAAACAATTGTTTGGAAAGAGGTATCTTATTGTCTTAGATGACGTGTGGGATACTAATACATGGGATGAGCTAACAAGACCTTTTCCTGATGGTATGAAAGGAAGTAGAATTATTTTGACAACTCGAGAAAAGAAAGTTGCTTTGCATGGAAAGCTCTACACTGATCCTCTTAACCTTCGATTGCTAAGATCAGAAGAAAGTTGGGAGTTATTAGAGAAAAGGGCATTTGGAAACGAGAGTTGCCCTGATGAACTATTGGATGTTGGTAAAGAAATAGCCGAAAATTGTAAAGGGCTTCCTTTGGTGGTGGATCTGATTGCTGGAATCATTGCTGGGAGGGAAAAGAAAAAGAGTGTGTGGCTTGAAGTTGTAAATAATTTGCATTCCTTTATTTTGAAGAATGAAGTGGAAGTGATGAAAGTTATAGAAATAAGTTATGACCACTTACCTGATCACCTGAAGCCATGCTTGCTGTACTTTGCAAGTGCGCCGAAGGACTGGGTAACGACAATCCATGAGTTGAAACTTATTTGGGGTTTTGAAGGATTTGTGGAAAAGACAGATATGAAGAGTCTGGAAGAAGTGGTGAAAATTTATTTGGATGATTTAATTTCCAGTAGCTTGGTAATTTGTTTCAATGAGATAGGTGATTACCCTACTTGCCAACTTCATGATCTTGTGCATGACTTTTGTTTGATAAAAGCAAGAAAGGAAAAGTTGTGTGATCGGATAAGTTCAAGTGCTCCATCAGATTTGTTGCCACGTCAAATTAGCATTGATTATGATGATGATGAAGAGCACTTTGGGCTTAATTTTGTCCTGTTCGGTTCAAATAAGAAAAGGCATTCCGGTAAACACCTCTATTCTTTGACCATAAATGGAGATGAGCTGGACGACCATCTTTCTGATACATTTCATCTAAGACACTTGAGGCTTCTTAGAACCTTGCACCTGGAATCCTCTTTTATCATGGTTAAAGATTCTTTGCTGAATGAAATATGCATGTTGAATCATTTGAGGTACTTAAGCATTGGGACAGAAGTTAAATCTCTGCCTTTGTCTTTCTCAAACCTCTGGAATCTAGAAATCTTGTTTGTGGATAACAAAGAATCAACCTTGATACTATTACCGAGAATTTGGGATCTTGTAAAGTTGCAAGTGCTGTTCACGACTGCTTGTTCTTTCTTTGATATGGATGCAGATGAATCAATACTGATAGCAGAGGACACAAAGTTAGAGAACTTGACAGCATTAGGGGAACTCGTGCTTTCCTATTGGAAAGATACAGAGGATATTTTCAAAAGGCTTCCCAATCTTCAAGTGCTTCATTTCAAACTCAAGGAGTCATGGGATTATTCAACAGAGCAATATTGGTTCCCGAAATTGGATTTCCTAACTGAACTAGAAAAACTCACTGTAGATTTTGAAAGATCAAACACAAATGACAGTGGGTCCTCTGCAGCCATAAATCGGCCATGGGATTTTCACTTTCCTTCGAGTTTGAAAAGATTGCAATTGCATGAATTTCCTCTGACATCCGATTCACTATCAACAATAGCGAGACTGCTGAACCTTGAAGAGTTGTACCTTTATCGTACAATCATCCATGGGGAAGAATGGAACATGGGAGAAGAAGACACCTTTGAGAATCTCAAATGTTTGATGTTGAGTCAAGTGATTCTTTCCAAGTGGGAGGTTGGAGAGGAATCTTTTCCCACGCTTGAGAAATTAGAACTGTCGGACTGTCATAATCTTGAGGAGATTCCGTCTAGTTTTGGGGATATTTATTCCTTGAAAATTATCGAACTTGTAAGGAGCCCTCAACTTGAAAATTCCGCTCTCAAGATTAAGGAATATGCTGAAGATATGAGGGGAGGGGACGAGCTTCAGATCCTTGGCCAGAAGGATATCCCGTTATTTAAGTAG


Protein sequences

Name Description Sequence
late blight resistance protein Rpi-blb2 late blight resistance protein Rpi-blb2 [Solanum bulbocastanum].

MEKRKDNEEANNSLESFSALRKDAANVLDFLERLKNEEDQKAVDVDLIESLKLKLTFICTYVQLSYSDLEKFEDIMTRKRQEVENLLQPILDDDGKDVGCKYVLTSLAGNMDDCISLYHRSKSDATMMDEQLGFLLLNLSHLSKHRAEKMFPGVTQYEVLQNVCGNIRDFHGLIVNCCIKHEMVENVLSLFQLMAERVGRFLWEDQADEDSQLSELDEDDQNDKDPQLFKLAHLLLKIVPTELEVMHICYKTLKASTSTEIGRFIKKLLETSPDILREYLIHLQEHMITVITPNTSGARNIHVMMEFLLIILSDMPPKDFIHHDKLFDLLARVVALTREVSTLVRDLEEKLRIKESTDETNCATLKFLENIELLKEDLKHVYLKVPDSSQYCFPMSDGPLFMHLLQRHLDDLLDSNAYSIALIKEQIGLVKEDLEFIRSFFANIEQGLYKDLWERVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITRKKMMLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTDMKSLEEVVKIYLDDLISSSLVICFNEIGDYPTCQLHDLVHDFCLIKARKEKLCDRISSSAPSDLLPRQISIDYDDDEEHFGLNFVLFGSNKKRHSGKHLYSLTINGDELDDHLSDTFHLRHLRLLRTLHLESSFIMVKDSLLNEICMLNHLRYLSIGTEVKSLPLSFSNLWNLEILFVDNKESTLILLPRIWDLVKLQVLFTTACSFFDMDADESILIAEDTKLENLTALGELVLSYWKDTEDIFKRLPNLQVLHFKLKESWDYSTEQYWFPKLDFLTELEKLTVDFERSNTNDSGSSAAINRPWDFHFPSSLKRLQLHEFPLTSDSLSTIARLLNLEELYLYRTIIHGEEWNMGEEDTFENLKCLMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELVRSPQLENSALKIKEYAEDMRGGDELQILGQKDIPLFK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
381-864 PTHR11017:SF126,OS11G0237600 PROTEIN

VYLKVPDSSQYCFPMSDGPLFMHLLQRHLDDLLDSNAYSIALIKEQIGLVKEDLEFIRSFFANIEQGLYKDLWERVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITRKKMMLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTDMKSLEEVVKIYLDDLISSSLVICFNEIGDYPTCQLHDLVHDFCLIKARKE

HMMPanther: PTHR11017
381-864 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VYLKVPDSSQYCFPMSDGPLFMHLLQRHLDDLLDSNAYSIALIKEQIGLVKEDLEFIRSFFANIEQGLYKDLWERVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITRKKMMLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTDMKSLEEVVKIYLDDLISSSLVICFNEIGDYPTCQLHDLVHDFCLIKARKE

superfamily: SSF52540
513-760 SSF52540

VVNSPKKPVESKSLTTDKIIVGFGEETNLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKN

HMMPfam: PF00931
IPR002182
540-814 NB-ARC,NBS
NB-ARC

NLILRKLTSGPADLDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKKVALHGKLYTDPLNLRLLRSEESWELLEKRAFGNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFILKNEVEVMKVIEISYDHLPDHLKPCLLYFASAPKDWVTTIHELKLIWGFEGFVEKTD

Gene3D: G3DSA:3.40.50.300
553-671 G3DSA:3.40.50.300

LDVISIIGMPGLGKTTLAYKVYNDKSVSSHFDLRAWCTVDQVYDEKKLLDKIFNQVSDSNSKLSENIDVADKLRKQLFGKRYLIVLDDVWDTNTWDELTRPFPDGMKGSRIILTTREKK

FPrintScan: PR00364
IPR000767
555-570 DISEASERSIST
Disease resistance protein

VISIIGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
628-642 DISEASERSIST
Disease resistance protein

QLFGKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
722-736 DISEASERSIST
Disease resistance protein

CKGLPLVVDLIAGII

superfamily: SSF52058
848-1231 SSF52058,LRR

QLHDLVHDFCLIKARKEKLCDRISSSAPSDLLPRQISIDYDDDEEHFGLNFVLFGSNKKRHSGKHLYSLTINGDELDDHLSDTFHLRHLRLLRTLHLESSFIMVKDSLLNEICMLNHLRYLSIGTEVKSLPLSFSNLWNLEILFVDNKESTLILLPRIWDLVKLQVLFTTACSFFDMDADESILIAEDTKLENLTALGELVLSYWKDTEDIFKRLPNLQVLHFKLKESWDYSTEQYWFPKLDFLTELEKLTVDFERSNTNDSGSSAAINRPWDFHFPSSLKRLQLHEFPLTSDSLSTIARLLNLEELYLYRTIIHGEEWNMGEEDTFENLKCLMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELVR

Gene3D: G3DSA:3.80.10.10
911-1101 G3DSA:3.80.10.10

KHLYSLTINGDELDDHLSDTFHLRHLRLLRTLHLESSFIMVKDSLLNEICMLNHLRYLSIGTEVKSLPLSFSNLWNLEILFVDNKESTLILLPRIWDLVKLQVLFTTACSFFDMDADESILIAEDTKLENLTALGELVLSYWKDTEDIFKRLPNLQVLHFKLKESWDYSTEQYWFPKLDFLTELEKLTVDF

Gene3D: G3DSA:3.80.10.10
1118-1230 G3DSA:3.80.10.10

PWDFHFPSSLKRLQLHEFPLTSDSLSTIARLLNLEELYLYRTIIHGEEWNMGEEDTFENLKCLMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELV

FPrintScan: PR00364
IPR000767
1195-1211 DISEASERSIST
Disease resistance protein

ESFPTLEKLELSDCHNL


Diseases

Disease Pathogen Avirulence gene
Late Blight Tomato Phytophthora infestans

List of References

Edwin A G van der Vossen, Jack Gros, Anne Sikkema, Marielle Muskens, Doret Wouters, Petra Wolters, Andy Pereira, Sjefke Allefs
The Rpi-blb2 gene from Solanum bulbocastanum is an Mi-1 gene homolog conferring broad-spectrum late blight resistance in potato.
Plant J.: 2005, 44(2);208-22
PubMed:16212601 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox