PRGDB00000050 (Rx)

From PRG Wiki
Jump to: navigation, search
Rx
Gene Type Reference_R-Genes,_manually_curated
GenBank 5524753 (AJ011801)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 12
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum rx gene.

DNA Sequence

ATGGCTTATGCTGCTGTTACTTCCCTTATGAGAACCATACATCAATCAATGGAACTTACTGGATGTGATTTGCAACCGTTTTATGAAAAGCTCAAATCTTTGAGAGCTATTCTGGAGAAATCCTGCAATATAATGGGCGATCATGAGGGGTTAACAATCTTGGAAGTTGAAATCGTAGAGGTAGCATACACAACAGAAGATATGGTTGACTCGGAATCAAGAAATGTTTTTTTAGCACAGAATTTGGAGGAAAGAAGCAGGGCTATGTGGGAGATTTTTTTCGTCCTGGAACAAGCACTAGAATGCATTGATTCCACCGTGAAACAGTGGATGGCAACATCGGACAGCATGAAAGATCTAAAACCACAAACTAGCTCGCTTGTCAGTTTACCTGAACATGATGTTGAGCAGCCCGAGAATATAATGGTTGGCCGTGAAAATGAATTTGAGATGATGCTGGATCAACTTGCTAGAGGAGGAAGGGAACTAGAAGTTGTCTCAATCGTAGGGATGGGAGGCATCGGGAAAACAACTTTGGCTACAAAACTCTATAGTGATCCGTGCATTATGTCTCGATTTGATATTCGTGCAAAAGCAACTGTTTCACAAGAGTATTGTGTGAGAAATGTACTCCTAGGCCTTCTTTCTTTGACAAGTGATGAACCTGATGATCAGCTAGCGGACCGACTGCAAAAGCATCTGAAAGGCAGGAGATACTTGGTAGTCATTGATGACATATGGACTACAGAAGCTTGGGATGATATAAAACTATGTTTCCCAGACTGTTATAATGGAAGCAGAATACTCCTGACTACTCGGAATGTGGAAGTGGCTGAATATGCTAGTTCAGGTAAGCCTCCTCATCACATGCGCCTCATGAATTTTGACGAAAGTTGGAATTTACTACACAAAAAGATCTTTGAAAAAGAAGGTTCTTATTCTCCTGAATTTGAAAATATTGGGAAACAAATTGCATTAAAATGTGGAGGATTACCTCTAGCAATTACTGTGATTGCTGGACTTCTCTCCAAAATGGGTCAAAGATTAGATGAGTGGCAAAGAATTGGGGAAAATGTAAGTTCGGTCGTTAGCACAGATCCTGAAGCACAATGCATGAGAGTGTTGGCTTTGAGTTACCATCACTTGCCTTCTCACCTAAAACCGTGTTTTCTGTATTTTGCAATTTTCACAGAGGATGAACAGATTTCTGTAAATGAACTTGTTGAGTTATGGCCTGTAGAGGGATTTTTGAATGAAGAAGAGGGAAAAAGCATAGAAGAGGTGGCAACAACATGTATAAACGAACTTATAGATAGAAGCTTAATTTTCATCCACAATTTTAGTTTTCGTGGAACAATAGAAAGTTGTGGAATGCATGATGTGACCCGTGAACTCTGTTTGAGGGAAGCTCGAAACATGAATTTTGTGAATGTTATCAGAGGAAAGAGTGATCAAAATTCATGTGCACAATCCATGCAGCGTTCCTTTAAGAGTCGAAGTCGGATCAGAATCCATAAGGTGGAAGAATTGGCTTGGTGTCGTAACAGTGAGGCTCATTCTATTATCATGTTGGGTGGATTCGAATGCGTCACACTGGAATTGTCTTTCAAGCTAGTAAGAGTACTAGATCTTGGTTTGAATACATGGCCAATTTTTCCCAGTGGAGTACTTTCTCTAATTCATTTGAGATACCTATCTTTGCGTTTTAATCCTTGCTTACAGCAGTATCAAGGATCGAAAGAAGCTGTTCCCTCATCAATAATAGACATTCCTCTATCGATATCAAGCCTATGCTATCTGCAAACTTTTAAACTTAACCTTCCATTTCCCAGTTATTATCCTTTCATATTACCATCGGAAATTTTGACGATGCCACAATTGAGGACGCTGTGTATGGGCTGGAATTACTTGCGGAGTCATGAGCCTACAGAGAACAGATTGGTTTTGAAAAATTTGCAATGCCTCAATCAATTGAACCCTCGGTATTGTACAGGGTCTTTTTTTAGACTATTTCCCAATTTAAAGAAGTTGCAAGTATTTGGCGTCCCAGAAGACTTTCGCAATAGCCAGGACCTGTATGATTTTCGCTACTTATATCAGCTCGAAGAATTGACATTTCGTTTATATTATCCATATGCTGCTTGCTTTCTAAAAAACACTGCACCTTCAGGTTCTACGCAAGATCCTCTGAGGTTTCAGACGGAAATATTGCACAAAGAGATTGATTTCGGGGGAACTGCACCTCCAACTTTACTCTTACCTCCTCCGGATGCTTTTCCACAAAACCTTAAGAGTTTAACTTTTAGGGGAGAATTCTCTGTGGCATGGAAGGATTTGAGCATTGTTGGTAAATTACCCAAACTCGAGGTCCTTATACTATCATGGAATGCCTTCATAGGCAAGGAGTGGGAAGTAGTTGAGGAAGGGTTTCCTCACTTGAAGTTCTTGTTTCTGGATGATGTATACATTCGATACTGGAGAGCTAGTAGTGATCACTTTCCGTACCTTGAACGAGTTATTCTTAGAGATTGCCGTAATTTGGATTCAATCCCTCGAGATTTTGCAGATATAACCACACTAGCTCTTATTGATATAGATTACTGTCAACAATCTGTTGTGAATTCCGCCAAGCAAATTCAACAGGACATTCAAGACAACTATGGAAGCTCTATCGAGGTCCATACTCGTCATCTTTTCATTCCCAAGAGTGTGACAACAGTTGAAGATGATGATGATAGTGTGACAACAGATGAAGATGATGATGATGATGACTTTGAGAAAGAAGTTGCTTCTTGCCGCAATAATGTCGAGTAG


Protein sequences

Name Description Sequence
Rx protein Rx protein [Solanum tuberosum].

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTEDEQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQRSFKSRSRIRIHKVEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDLGLNTWPIFPSGVLSLIHLRYLSLRFNPCLQQYQGSKEAVPSSIIDIPLSISSLCYLQTFKLNLPFPSYYPFILPSEILTMPQLRTLCMGWNYLRSHEPTENRLVLKNLQCLNQLNPRYCTGSFFRLFPNLKKLQVFGVPEDFRNSQDLYDFRYLYQLEELTFRLYYPYAACFLKNTAPSGSTQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLKFLFLDDVYIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQQDIQDNYGSSIEVHTRHLFIPKSVTTVEDDDDSVTTDEDDDDDDFEKEVASCRNNVE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF129
1-480 PTHR11017:SF129

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTEDEQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDVTRELCLREARNMNFVNVIR

HMMPanther: PTHR11017
1-480 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIVEVAYTTEDMVDSESRNVFLAQNLEERSRAMWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTEDEQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDVTRELCLREARNMNFVNVIR

superfamily: SSF52540
117-366 SSF52540

MKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSVVSTD

HMMPfam: PF00931
IPR002182
145-420 NB-ARC,NBS
NB-ARC

RENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMGQRLDEWQRIGENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTEDEQISVNELVELWPVEGFLNEE

Gene3D: G3DSA:3.40.50.300
150-276 G3DSA:3.40.50.300

EMMLDQLARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVE

FPrintScan: PR00364
IPR000767
165-180 DISEASERSIST
Disease resistance protein

VVSIVGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
233-247 DISEASERSIST
Disease resistance protein

HLKGRRYLVVIDDIW

FPrintScan: PR00364
IPR000767
328-342 DISEASERSIST
Disease resistance protein

CGGLPLAITVIAGLL

superfamily: SSF52058
457-874 SSF52058,LRR

GMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQRSFKSRSRIRIHKVEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDLGLNTWPIFPSGVLSLIHLRYLSLRFNPCLQQYQGSKEAVPSSIIDIPLSISSLCYLQTFKLNLPFPSYYPFILPSEILTMPQLRTLCMGWNYLRSHEPTENRLVLKNLQCLNQLNPRYCTGSFFRLFPNLKKLQVFGVPEDFRNSQDLYDFRYLYQLEELTFRLYYPYAACFLKNTAPSGSTQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLKFLFLDDVYIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVN

Gene3D: G3DSA:3.80.10.10
536-666 G3DSA:3.80.10.10

FKLVRVLDLGLNTWPIFPSGVLSLIHLRYLSLRFNPCLQQYQGSKEAVPSSIIDIPLSISSLCYLQTFKLNLPFPSYYPFILPSEILTMPQLRTLCMGWNYLRSHEPTENRLVLKNLQCLNQLNPRYCTGS

Gene3D: G3DSA:3.80.10.10
757-880 G3DSA:3.80.10.10

DAFPQNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLKFLFLDDVYIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQ

FPrintScan: PR00364
IPR000767
783-799 DISEASERSIST
Disease resistance protein

GKLPKLEVLILSWNAFI


Diseases

Disease Pathogen Avirulence gene
Latent Mosaic Potato virus X PRGAV00000039
Beet cyst nematode Potato virus X PRGAV00000039

List of References

A Bendahmane, K Kanyuka, D C Baulcombe
The Rx gene from potato controls separate virus resistance and cell death responses.
Plant Cell: 1999, 11(5);781-92
PubMed:10330465 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox