PRGDB00000051 (Rx2)

From PRG Wiki
Jump to: navigation, search
Rx2
Gene Type Reference_R-Genes,_manually_curated
GenBank 5918253 (AJ249448)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 5
Gene Species Solanum acaule

Comment?

Solanum acaule Rx2.ac15 gene for NBS-LRR protein, exons 1-3.

DNA Sequence

ATGGCTTATGCTGCTGTTACTTCCCTTATGAGAACCATACATCAATCAATGGAACTTACTGGATGTGATTTGCAACCGTTTTATGAAAAGCTCGAATCTTTAAGAGCTATTCTGGAGAAATCCTGCAATGTAACGGGCGATCATGAGGAGTTAACAATCTTGGAAGTTGAAATCTTAGAGGTAGCATACACAACAGAAGATATGGTTGACTCGGAATCAAGAAGTGTTTTTTTAGCACAGAATTTGGAGGAAAGAAACAGGGCTATGTGGGAGATTTTTTTCGTCTTGGAACAAGCACTAGAATGCATTGATTCCACCGTGAAACAGTGGATGGCAACATCGGACAGCATGAAAGATCTAAAACCACAAACTAGCTCACTTGTCAGTTTACCTGACCATGCTTTTGAGCAGCCTGAGAATATAATGGTTGGCCGTGAAAATGAATTTGAGATGATGCTGGATCAACTTGTTAGAGGAGGAAGGGAACTAGAAGTTGTCTCAATCGTAGGGATGGGAGGTATCGGGAAAACAACTTTGGCTACAAAACTCTATAGTGATCCTTACATTATGTCTCGATTTGATATTCGTGCAAAAGCAACTGTTTCACAAGAGTATTGTGTGAGAAATGTACTCCTAGGCCTTCTTTCTTTGACAAGTGATGAACCTGATGATCAACTAGCGGACCGACTGCAAAAGCATCTGAAAGGCAGGAGATACTTGGTAGTCATTGATGACATATGGACTACAAAAGCTTGGGATGGTATAAAACTATGTTTCCCAGACTGTTATAAGGGAAGCAGAATACTCCTGACTACTCGGAATGTGGAAGTGGCTGAATATGCTAGTTCAGGTAAGCCTCCTCATCACATGCGCCTCATGAATTTTGACGAAAGTTGGAATTTACTACACAAAAAGATCTTTGAAAAAGAAGGTTCTTATTCTCCTGAATTTGAAAATATTGGGAAACAAATTGCATTAAAATGTGGAGGATTACCTCTAGCAATTACTGTGATTGCTGGACTTCTCTCCAAAATCAGTAAAACATTGGATGAGTGGCAAAATGTTGCGGAGAATGTAAGTTCGGTGGTAAGCACAGATCTTGAAGCAAAATGCATGAGAGTGTTGGCTTTGAGTTACCATCACTTGCCTTCTCACCTAAAACCGTGTTTTCTATATTTTGCAATTTTCGCAGAGGATGAACGGATTTCTGTAACTAAACTTGTTGAGTTATGGGCTGTAGAGGGGTTTTTGAATGAAGAAGAGGGAAAAAGCATAGAAGAGGTGGCAGAAACATGTATAAACGAGCTTGTAGATAGAAGTCTAATTTCTATCCACAATTTGAGTTTTGATGGGAAAATAGAAAGTTGTGGAATGCATGATGTGACCCGTGAACTCTGTTTGAGGGAAGCTCGAAACATGAATTTTGTAAATGTTATCAGAGGAAAGAGTGATCAAAATTCATGTGCACAATCCATGCAGCGTTCCTTTAAGAGTCGAAGTCGGATCAGAATCCATAAGCTGGAAGAATTGGCTTGGTGTCGTAACAGTGAGGCTCATTCTATTATCATGTTGGGTGGATTCGAATGCGTCACACTGGAATTGTCTTTCAAGCTAGTAAGAGTACTAGATCTTGGTTTGAATACATGGCCAATTTTTCCCAGTGGAGTACTTTCTCTAATTCATTTGAGATACCTATCTTTGCGTTTTAATCCTTGCTTACAGCAGTATCAAGGATCGAAAGAAGCTGTTCCCTCATCAATAATAGACATTCCTCTATCGATATCAAGCCTATGCTATCTGCAAACTTTTAAACTTAACCTTCCATTTCCCAGTTATTATCCTTTCATATTACCATCGGAAATTTTGACGATGCCACAATTGAGGACGCTGTGTATGGACTGGAATTACTTGCGGAGTCATGAGCCTACAGAGAACAGATTGGTTTTGAAAAATTTGCAATGCCTCAATCAATTGAACCCTCGGTATTGTACAGGGTCTTTTTTTAGACTATTTCCCAATTTAAAGAAGTTGCAAGTATTTGGCGTCCCAGAAGACTTTCGCAATAGCCAGGACCTGTATGATTTTCGCTACTTATATCAGCTCGAAGAATTGACATTTCGTTTATATTATCCATATGCTGCTTGCTTTCTAAAAAACACTGCACCTTCAGGTTCTACTCCGCAAGATCCTCTGAGGTTTCAGACGGAAATATTGCACAAAGAGATTGATTTCGGGGGAACTGCACCTCCAACTTTACTCTTACCTCCTCCGGATGCTTTTCCACAAAACCTTAAGAGTTTAACTTTTAGGGGAGAATTCTCTGTGGCATGGAAGGATTTGAGCATTGTTGGTAAATTACCCAAACTCGAGGTCCTTATACTATCATGGAATGCCTTCATAGGCAAGGAGTGGGAAGTAGTTGAGGAAGGGTTTCCTCACTTGAACTTCTTGTTTCTGGATGATGTATACATTCGATACTGGAGAGCTAGTAGTGATCACTTTCCGTACCTTGAACGACTTATTCTTAGAGATTGCCGTAATTTGGATTCAATCCCTCGAGATTTTGCAGATATAACCACACTAGCTCTTATTGATATAGATTACTGTCAACAATCTGTTGTGAATTCCGCCAAGCAAATTCAACAGGACATTCAAGACAACTATGGAAGCTCTATCGAGGTCCATACTCGTCATCTTTTCATTCCCAAGAGTGTGACAACAGTTGAAGATGATGATGATAGTGTGACAACAGATGAAGATGATGATGATGATGACTTTGAGAAAGAAGTTGCTTCTTGCCGCAATAATGTCGAGTAG


Protein sequences

Name Description Sequence
NBS-LRR protein NBS-LRR protein [Solanum acaule].

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLESLRAILEKSCNVTGDHEELTILEVEILEVAYTTEDMVDSESRSVFLAQNLEERNRAMWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPDHAFEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQRSFKSRSRIRIHKLEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDLGLNTWPIFPSGVLSLIHLRYLSLRFNPCLQQYQGSKEAVPSSIIDIPLSISSLCYLQTFKLNLPFPSYYPFILPSEILTMPQLRTLCMDWNYLRSHEPTENRLVLKNLQCLNQLNPRYCTGSFFRLFPNLKKLQVFGVPEDFRNSQDLYDFRYLYQLEELTFRLYYPYAACFLKNTAPSGSTPQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLNFLFLDDVYIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQQDIQDNYGSSIEVHTRHLFIPKSVTTVEDDDDSVTTDEDDDDDDFEKEVASCRNNVE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF14
1-480 PTHR11017:SF14

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLESLRAILEKSCNVTGDHEELTILEVEILEVAYTTEDMVDSESRSVFLAQNLEERNRAMWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPDHAFEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKIESCGMHDVTRELCLREARNMNFVNVIR

HMMPanther: PTHR11017
1-480 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLESLRAILEKSCNVTGDHEELTILEVEILEVAYTTEDMVDSESRSVFLAQNLEERNRAMWEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPDHAFEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKIESCGMHDVTRELCLREARNMNFVNVIR

superfamily: SSF52540
125-367 SSF52540

SSLVSLPDHAFEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDL

HMMPfam: PF00931
IPR002182
145-420 NB-ARC,NBS
NB-ARC

RENEFEMMLDQLVRGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKISKTLDEWQNVAENVSSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERISVTKLVELWAVEGFLNEE

Gene3D: G3DSA:3.40.50.300
154-274 G3DSA:3.40.50.300

DQLVRGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDDQLADRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRN

FPrintScan: PR00364
IPR000767
165-180 DISEASERSIST
Disease resistance protein

VVSIVGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
233-247 DISEASERSIST
Disease resistance protein

HLKGRRYLVVIDDIW

FPrintScan: PR00364
IPR000767
328-342 DISEASERSIST
Disease resistance protein

CGGLPLAITVIAGLL

superfamily: SSF52058
457-875 SSF52058,LRR

GMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQRSFKSRSRIRIHKLEELAWCRNSEAHSIIMLGGFECVTLELSFKLVRVLDLGLNTWPIFPSGVLSLIHLRYLSLRFNPCLQQYQGSKEAVPSSIIDIPLSISSLCYLQTFKLNLPFPSYYPFILPSEILTMPQLRTLCMDWNYLRSHEPTENRLVLKNLQCLNQLNPRYCTGSFFRLFPNLKKLQVFGVPEDFRNSQDLYDFRYLYQLEELTFRLYYPYAACFLKNTAPSGSTPQDPLRFQTEILHKEIDFGGTAPPTLLLPPPDAFPQNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLNFLFLDDVYIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVN

Gene3D: G3DSA:3.80.10.10
535-666 G3DSA:3.80.10.10

SFKLVRVLDLGLNTWPIFPSGVLSLIHLRYLSLRFNPCLQQYQGSKEAVPSSIIDIPLSISSLCYLQTFKLNLPFPSYYPFILPSEILTMPQLRTLCMDWNYLRSHEPTENRLVLKNLQCLNQLNPRYCTGS

Gene3D: G3DSA:3.80.10.10
758-881 G3DSA:3.80.10.10

DAFPQNLKSLTFRGEFSVAWKDLSIVGKLPKLEVLILSWNAFIGKEWEVVEEGFPHLNFLFLDDVYIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQ

FPrintScan: PR00364
IPR000767
784-800 DISEASERSIST
Disease resistance protein

GKLPKLEVLILSWNAFI


Diseases

Disease Pathogen Avirulence gene
Latent Mosaic Potato virus X PRGAV00000039
Beet cyst nematode Potato virus X PRGAV00000039

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox