PRGDB00000052 (RY-1)

From PRG Wiki
Jump to: navigation, search
RY-1
Gene Type Reference_R-Genes,_manually_curated
GenBank 16944810 (AJ300266)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Chromosome 11
Gene Species Solanum tuberosum subsp andigena

Comment?

Solanum tuberosum subsp. andigena ry-1 gene for resistance gene-like, exons 1-6, splice variants C38 and C19.

DNA Sequence

ATGGCATCATCATCTTCTTCTTCTGAGAGTAATTCACAGTATTCATGTCCTCAACGGAAGTACAAGTACGATGTGTTTCTAAGTTTTAGAGATGATAAAAGGCTAGAGAATGGTGATTCCCTCTCGAAAGAACTAGTGAAAGCTATAAAAGAGTCTCAAGTTGCTGTAATCATCTTCTCAAAGAATTATGCTACGTCGAGGTGGTGCCTGAATGAAGTAGTGAAGATTATGGAATGCAAGGAAGAGAATGGACAATTAGTCATACCAGTCTTCTATGATGTGGATCCATCAGATGTTCGGAAGCAAACGAAGAGCTTTGCAGAAGCCTTTGCCGAACACGAATCGAGGTATAAGGATGATGTTGAAGGAATGCAGAAGGTGCAACGATGGAGGACTGCTCTAAGTGAAGCTGCAGATCTAAAAGGATATGATATCCGTGAAAGGATTGAATCAGAATGTATTGGGGAACTTGTTAATGAAATTTCGCCCAAATTATGCGAGACTTCTTTATCTTATTTGACAGATGTTGTGGGAATAGATGCTCATTTAAAGAAAGTCAACTCCCTTCTAGAGATGAAAATCGATGATGTTCGGATTGTGTGGATCTGGGGAATGGGGGGAGTTGGTAAAACGACAATAGCAAGAGCTATTTTTGATATACTCTCATCTAAATTTGATGGTGCTTGTTTCCTTCCGGACAATAAAGAAAACAAGTATGAAATACATTCTCTGCAAAGTATCCTTCTCTCTAAACTGGTAGGGGAAAAAGAAAATTGTGTGCATGATAAGGAGGACGGGAGGCACCTGATGGCTCGTAGACTTCGTTTGAAGAAAGTTCTAGTTGTGCTTGATAACATAGATCATGAAGACCAATTGAAATACCTAGCAGGGGATCTTGGTTGGTTTGGCAATGGCACCAGAATTATTGCAACAACGAGAGACAAGCATTTCATTCGGAAAAATGATGCCGTATATCCTGTGACTACACTACTTGAACATGATGCTGTTCAGTTGTTCAACCAATATGCTTTCAAAAATGAAGTTCCAGATAAGTGTTTCGAGGAGATAACGTTGGAGGTAGTAAGTCATGCTGAAGGCCTTCCTTTAGCCCTGAAAGTGTGGGGTTCTTCCTTACATAAGAAGGATATACATGTGTGGAGGAGTGCTGTTGATCGAATAAAGAGGAACCCTAGTTCAAAAGTTGTTGAAAACCTCAAAGTAAGTTATGATGGGTTGGAGCGCGAAGATCAAGAGATATTTCTAGATATTGCATGCTTCTTAAGAGGGAGAAAACAAACCGAGATCAAGCAAATTCTTGAGAGCTGTGATTTTGGAGCTGATGACGGATTGAGGGTGCTGATTGACAAGTCTCTTGTGTTCATCTCTGAATATGATACGATTCAAATGCATGACTTAATACAAGAGATGGGTAAATACATAGTGACAATGCAAAAGGATCGGGGAGAAGTCACTAGACTATGGCTCACTCAAGATTTCGAAAAATTCTCAAATGCAAAAATACAAGGGACCAAGGCTATCGAAGCAATCTGGATACCAGAAATTCAAGACCTAAGCTTTAGAAAAAAGGCCATGAAAGATGTGGAAAAGCTTAGGATATTATACATCAATGGTTTTCATACACCTGATGGCTCCAACGATCAGTACCTTCCCAGCAACTTGCGCTGGTTCGACTGTTGTAAGTATCCTTGGGAATCATTGCCAGCCAAATTTGATCCTGACATGCTTGTTCATCTTGATCTCCAGCAGAGTTCACTGTTTCATTTATGGACTGGAACAAAGAAATTTCCTTTTCTACGGAGGCTAGATCTCAGCAGCTGTGCAAACCTGATGCGAACACCAGATTTCACGGATATGCCAAATTTGGAGTATTTGGGTCTGGAAGAGTGTAGTAATCTTAAAGAGGTTCATCATTCCCTGAGATGTTCCAAAAAACTCATTAAGTTAAATTTGAGAGATTGTAAAAACCTTGAGAGTTTTAGCTATGTTTGTTGGGAATCTCTTGAATGTCTACATCTACAAGGTTGCTCTAATTTAGAGAAATTTCCGAGGATCCGGGGAAAATTGAAGCCGGAGATAGAGATTCAAGTGCAACGCTCTGGGATAAGGAAACTACCATCAGCTATTATTCAGCACCAGTCTAGTCTTACAGAGCTAGATTTGAGTGGCATGAAAAACCTTGCAACACTTTCATGCAGCATTGGCGAGTTGAAAAGTTTGGTGATGCTAAAAGTGTCCTACTGCTCAAAACTCAAAAGCTTGCCAGAAGAGATAGGTGATTTAGAAAACTTGGAGATACTTAAGGCCGGATATACTCTAATCTCACAACCTCCGTCTTCCATCGTTCGCTTGAACAGGCTTAAATTTTTGACTTTTGCAAAACAAAAATCAGAAGTAGGCCTCGAAGATGAAGTGCACTTTGTCTTCCCTCCGGTGAATCAGGGATTATGCTCATTGAAAACTTTGAATCTCAGTTACTGCAATCTAAAAGACGAAGGACTTCCGCAAGACATCGGAAGCTTATCCTCTTTGGAAGTGTTGAATCTGAGGGGAAATAATTTTGAGCATTTGCCTCAAAGCTTGACCCGACTTAGTTCTCTTCAGTCCTTGGACTTATTAGATTGCAAGAGTCTTACACAGCTGCCGGAATTTCCACGGCAATTAGACACAATATATGCAGATTGGAACAATGATTCGATCTGTAATTCGTTGTTTCAAAATATCTCATCATTCCAGCATGACATCTGTGCTTCAGATTCCTTGTCACTAAGAGTGTTTACCAATGAGTGGAAAAATATCCCGAGATGGTTCCACCATCAGGGAAAAGATAAAAGTGTATCAGTCAAATTGCCTGAAAATTGGTATGTGTGCGATAACTTCTTGGGATTTGCTGTATGTTACTCTGGCTGCTTAATTGAAACCACAGCTCAATTCTTATGTGATGAGGGGATGCCGTGTATCACACAGAAACTTGCCTTACCCAAACATTCAGAAGAATTTCCAGAATCTGCTATTCATTTTTTCTTGGTACCTTCTGCTGGCTTATTGGATACATCTAAGGCAAACGGAAAAACACCAAATGATTATAGGCACATTATGTTATCTTTTTCGGAAGAGTTGAAGGAGTTTGGACTTCGTTTGTTGTATAGAGATGAATCTAAGCTTAAGGCCTTGTTTAAAATGACGGAAAATAATGATGAACCAACAGAATATTGCGTCGTGAAAAGGAGGGGTCAATATGATGAGGCCAGATGCTCCTCTTCTAAGAAACAAAGGTCACAGCTCTAA


Protein sequences

Name Description Sequence
resistance gene-like resistance gene-like [Solanum tuberosum subsp. andigena].

MASSSSSSESNSQYSCPQRKYKYDVFLSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALSEAADLKGYDIRERIESECIGELVNEISPKLCETSLSYLTDVVGIDAHLKKVNSLLEMKIDDVRIVWIWGMGGVGKTTIARAIFDILSSKFDGACFLPDNKENKYEIHSLQSILLSKLVGEKENCVHDKEDGRHLMARRLRLKKVLVVLDNIDHEDQLKYLAGDLGWFGNGTRIIATTRDKHFIRKNDAVYPVTTLLEHDAVQLFNQYAFKNEVPDKCFEEITLEVVSHAEGLPLALKVWGSSLHKKDIHVWRSAVDRIKRNPSSKVVENLKVSYDGLEREDQEIFLDIACFLRGRKQTEIKQILESCDFGADDGLRVLIDKSLVFISEYDTIQMHDLIQEMGKYIVTMQKDRGEVTRLWLTQDFEKFSNAKIQGTKAIEAIWIPEIQDLSFRKKAMKDVEKLRILYINGFHTPDGSNDQYLPSNLRWFDCCKYPWESLPAKFDPDMLVHLDLQQSSLFHLWTGTKKFPFLRRLDLSSCANLMRTPDFTDMPNLEYLGLEECSNLKEVHHSLRCSKKLIKLNLRDCKNLESFSYVCWESLECLHLQGCSNLEKFPRIRGKLKPEIEIQVQRSGIRKLPSAIIQHQSSLTELDLSGMKNLATLSCSIGELKSLVMLKVSYCSKLKSLPEEIGDLENLEILKAGYTLISQPPSSIVRLNRLKFLTFAKQKSEVGLEDEVHFVFPPVNQGLCSLKTLNLSYCNLKDEGLPQDIGSLSSLEVLNLRGNNFEHLPQSLTRLSSLQSLDLLDCKSLTQLPEFPRQLDTIYADWNNDSICNSLFQNISSFQHDICASDSLSLRVFTNEWKNIPRWFHHQGKDKSVSVKLPENWYVCDNFLGFAVCYSGCLIETTAQFLCDEGMPCITQKLALPKHSEEFPESAIHFFLVPSAGLLDTSKANGKTPNDYRHIMLSFSEELKEFGLRLLYRDESKLKALFKMTENNDEPTEYCVVKRRGQYDEARCSSSKKQRSQL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
11-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

NSQYSCPQRKYKYDVFLSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALSEAADLKGY

ProfileScan: PS50104
IPR000157
18-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QRKYKYDVFLSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALSEAADL

HMMSmart: SM00255
IPR000157
22-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALSEAADL

HMMPanther: PTHR11017
25-888 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VFLSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALSEAADLKGYDIRERIESECIGELVNEISPKLCETSLSYLTDVVGIDAHLKKVNSLLEMKIDDVRIVWIWGMGGVGKTTIARAIFDILSSKFDGACFLPDNKENKYEIHSLQSILLSKLVGEKENCVHDKEDGRHLMARRLRLKKVLVVLDNIDHEDQLKYLAGDLGWFGNGTRIIATTRDKHFIRKNDAVYPVTTLLEHDAVQLFNQYAFKNEVPDKCFEEITLEVVSHAEGLPLALKVWGSSLHKKDIHVWRSAVDRIKRNPSSKVVENLKVSYDGLEREDQEIFLDIACFLRGRKQTEIKQILESCDFGADDGLRVLIDKSLVFISEYDTIQMHDLIQEMGKYIVTMQKDRGEVTRLWLTQDFEKFSNAKIQGTKAIEAIWIPEIQDLSFRKKAMKDVEKLRILYINGFHTPDGSNDQYLPSNLRWFDCCKYPWESLPAKFDPDMLVHLDLQQSSLFHLWTGTKKFPFLRRLDLSSCANLMRTPDFTDMPNLEYLGLEECSNLKEVHHSLRCSKKLIKLNLRDCKNLESFSYVCWESLECLHLQGCSNLEKFPRIRGKLKPEIEIQVQRSGIRKLPSAIIQHQSSLTELDLSGMKNLATLSCSIGELKSLVMLKVSYCSKLKSLPEEIGDLENLEILKAGYTLISQPPSSIVRLNRLKFLTFAKQKSEVGLEDEVHFVFPPVNQGLCSLKTLNLSYCNLKDEGLPQDIGSLSSLEVLNLRGNNFEHLPQSLTRLSSLQSLDLLDCKSLTQLP

HMMPanther: PTHR11017:SF20
25-888 PTHR11017:SF20,SUBFAMILY NOT NAMED

VFLSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALSEAADLKGYDIRERIESECIGELVNEISPKLCETSLSYLTDVVGIDAHLKKVNSLLEMKIDDVRIVWIWGMGGVGKTTIARAIFDILSSKFDGACFLPDNKENKYEIHSLQSILLSKLVGEKENCVHDKEDGRHLMARRLRLKKVLVVLDNIDHEDQLKYLAGDLGWFGNGTRIIATTRDKHFIRKNDAVYPVTTLLEHDAVQLFNQYAFKNEVPDKCFEEITLEVVSHAEGLPLALKVWGSSLHKKDIHVWRSAVDRIKRNPSSKVVENLKVSYDGLEREDQEIFLDIACFLRGRKQTEIKQILESCDFGADDGLRVLIDKSLVFISEYDTIQMHDLIQEMGKYIVTMQKDRGEVTRLWLTQDFEKFSNAKIQGTKAIEAIWIPEIQDLSFRKKAMKDVEKLRILYINGFHTPDGSNDQYLPSNLRWFDCCKYPWESLPAKFDPDMLVHLDLQQSSLFHLWTGTKKFPFLRRLDLSSCANLMRTPDFTDMPNLEYLGLEECSNLKEVHHSLRCSKKLIKLNLRDCKNLESFSYVCWESLECLHLQGCSNLEKFPRIRGKLKPEIEIQVQRSGIRKLPSAIIQHQSSLTELDLSGMKNLATLSCSIGELKSLVMLKVSYCSKLKSLPEEIGDLENLEILKAGYTLISQPPSSIVRLNRLKFLTFAKQKSEVGLEDEVHFVFPPVNQGLCSLKTLNLSYCNLKDEGLPQDIGSLSSLEVLNLRGNNFEHLPQSLTRLSSLQSLDLLDCKSLTQLP

HMMPfam: PF01582
IPR000157
27-135 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LSFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRWRTALS

Gene3D: G3DSA:3.40.50.10140
28-130 G3DSA:3.40.50.10140

SFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEENGQLVIPVFYDVDPSDVRKQTKSFAEAFAEHESRYKDDVEGMQKVQRW

superfamily: SSF52540
159-401 SSF52540

NEISPKLCETSLSYLTDVVGIDAHLKKVNSLLEMKIDDVRIVWIWGMGGVGKTTIARAIFDILSSKFDGACFLPDNKENKYEIHSLQSILLSKLVGEKENCVHDKEDGRHLMARRLRLKKVLVVLDNIDHEDQLKYLAGDLGWFGNGTRIIATTRDKHFIRKNDAVYPVTTLLEHDAVQLFNQYAFKNEVPDKCFEEITLEVVSHAEGLPLALKVWGSSLHKKDIHVWRSAVDRIKRNPSSKV

Gene3D: G3DSA:3.40.50.300
173-319 G3DSA:3.40.50.300

LTDVVGIDAHLKKVNSLLEMKIDDVRIVWIWGMGGVGKTTIARAIFDILSSKFDGACFLPDNKENKYEIHSLQSILLSKLVGEKENCVHDKEDGRHLMARRLRLKKVLVVLDNIDHEDQLKYLAGDLGWFGNGTRIIATTRDKHFIR

HMMPfam: PF00931
IPR002182
184-431 NB-ARC,NBS
NB-ARC

KKVNSLLEMKIDDVRIVWIWGMGGVGKTTIARAIFDILSSKFDGACFLPDNKENKYEIHSLQSILLSKLVGEKENCVHDKEDGRHLMARRLRLKKVLVVLDNIDHEDQLKYLAGDLGWFGNGTRIIATTRDKHFIRKNDAVYPVTTLLEHDAVQLFNQYAFKNEVPDKCFEEITLEVVSHAEGLPLALKVWGSSLHKKDIHVWRSAVDRIKRNPSSKVVENLKVSYDGLEREDQEIFLDIACFLRGRK

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

IVWIWGMGGVGKTTIA

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

RLRLKKVLVVLDNID

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

AEGLPLALKVWGSSL

superfamily: SSF46785
399-504 SSF46785

SKVVENLKVSYDGLEREDQEIFLDIACFLRGRKQTEIKQILESCDFGADDGLRVLIDKSLVFISEYDTIQMHDLIQEMGKYIVTMQKDRGEVTRLWLTQDFEKFSN

superfamily: SSF52058
468-897 SSF52058,LRR

QMHDLIQEMGKYIVTMQKDRGEVTRLWLTQDFEKFSNAKIQGTKAIEAIWIPEIQDLSFRKKAMKDVEKLRILYINGFHTPDGSNDQYLPSNLRWFDCCKYPWESLPAKFDPDMLVHLDLQQSSLFHLWTGTKKFPFLRRLDLSSCANLMRTPDFTDMPNLEYLGLEECSNLKEVHHSLRCSKKLIKLNLRDCKNLESFSYVCWESLECLHLQGCSNLEKFPRIRGKLKPEIEIQVQRSGIRKLPSAIIQHQSSLTELDLSGMKNLATLSCSIGELKSLVMLKVSYCSKLKSLPEEIGDLENLEILKAGYTLISQPPSSIVRLNRLKFLTFAKQKSEVGLEDEVHFVFPPVNQGLCSLKTLNLSYCNLKDEGLPQDIGSLSSLEVLNLRGNNFEHLPQSLTRLSSLQSLDLLDCKSLTQLPEFPRQLDTI

Gene3D: G3DSA:3.80.10.10
506-800 G3DSA:3.80.10.10

KIQGTKAIEAIWIPEIQDLSFRKKAMKDVEKLRILYINGFHTPDGSNDQYLPSNLRWFDCCKYPWESLPAKFDPDMLVHLDLQQSSLFHLWTGTKKFPFLRRLDLSSCANLMRTPDFTDMPNLEYLGLEECSNLKEVHHSLRCSKKLIKLNLRDCKNLESFSYVCWESLECLHLQGCSNLEKFPRIRGKLKPEIEIQVQRSGIRKLPSAIIQHQSSLTELDLSGMKNLATLSCSIGELKSLVMLKVSYCSKLKSLPEEIGDLENLEILKAGYTLISQPPSSIVRLNRLKFLTFAK

HMMPfam: PF07725
IPR011713
582-600 LRR_3
Leucine-rich repeat 3

LVHLDLQQSSLFHLWTGTK

Gene3D: G3DSA:3.80.10.10
816-944 G3DSA:3.80.10.10

PPVNQGLCSLKTLNLSYCNLKDEGLPQDIGSLSSLEVLNLRGNNFEHLPQSLTRLSSLQSLDLLDCKSLTQLPEFPRQLDTIYADWNNDSICNSLFQNISSFQHDICASDSLSLRVFTNEWKNIPRWFH

HMMPfam: PF12799
824-864 LRR_4,Leucine Rich repeats (2 copies)

SLKTLNLSYCNLKDEGLPQDIGSLSSLEVLNLRGNNFEHLP

ProfileScan: PS51450
IPR001611
824-844 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLNLSYCNLKDEGLPQDI

ProfileScan: PS51450
IPR001611
849-871 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLNLRGNNFEHLPQSLTRLS

FPrintScan: PR00364
IPR000767
868-884 DISEASERSIST
Disease resistance protein

TRLSSLQSLDLLDCKSL

HMMPfam: PF13504
871-888 LRR_7,Leucine rich repeat

SSLQSLDLLDCKSLTQLP

ProfileScan: PS51450
IPR001611
872-894 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLDLLDCKSLTQLPEFPRQL


Diseases

Disease Pathogen Avirulence gene
Potato virus Y Potato virus Y

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox