PRGDB00000053 (Sw-5)

From PRG Wiki
Jump to: navigation, search
Sw-5
Gene Type Reference_R-Genes,_manually_curated
GenBank 15418708 (AY007366)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 9
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum tospovirus resistance protein A (Sw5-a) and tospovirus resistance protein B (Sw5-b) genes, complete cds.

DNA Sequence

ATGGCTGAAAATGAAATTGAGGAAATGTTAGAGCACCTGAGAAGGATCAAGAGTGGAGGTGATCTGGATTGGCTCGACATATTGCGAATTGAAGAACTTGAAATGGTGCTAAGAGTTTTTAGAACCTTTACAAAGTATCATGATGTTCTTTTGCCTGATTCCTTAGTCGAACTCACAAAGAGGGCCAAATTGACTGGGGAAATACTTCACCGGGTGTTGGGTAGGATTCCACATAAATGTAAAACTAACCTTAATCTGGAAAGGCTAGAATCACATTTGTTGGAATTCTTTCAAGGTAATACGGCAAGTTTAAGTCACAATTATGAGTTGAATGATTTTGATCTGTCGAAATATATGGATTGTCTGGAAAATTTTCTAAATGATGTACTGATGATGTTCTTGCAAAAGGATAGGTTCTTCCATTCCAGAGAACAACTTGCAAAACATCGATCAATAAAGGAACTGAAAATTGTTCAAAAGAAAATAAGATTTTTGAAATACATATATGCCACAGAGATAAATGGTTATGTCGACTATGAGAAGCAGGAATGTTTGGAGACTCGAATTCAGTTCATGACTAACACTGTGGGACAATATTGTTTGGCAGTATTAGATTATGTCACTGAGGGTAAACTTAATGAAGAAAATGACAACTTTAGTAAACCTCCTTACCTATTATCATTGATTGTGTTAGTGGAGCTGGAAATGAAGAAGATTTTTCATGGTGAAGTAAAGGCTTCAAAGTTTACTCAATCAAAAACTTTCAAGGACAAGAAATTACCAAAAGGATTTTCACATCATCTCCACAATCTGTTGATGTATCTCAGAAACAAAAAGCTCGAGAATTTTCCTAATAATATCGCTGCTCAAAATATTGATGTGGCAATAGAGTTCTTGTTGGTTTTCCTTGATGCTGATGTGTCAAATCATGTTATTAATGGTAACTGGTTGAAAGAGGTCTTGTTAAAGGTTGGAGCTATAGCGGGTGATATTCTATATGTAATTCAAAAGCTTCTTCCTAGATCAATAAACAAAGATGAAACTAGCAACATAAGTCTTTGCTCAATACAGATATTGGAGAAGACTAAAGATCTGAAGGCACAAGTTGAGACGTACTACAAATCCTTAAAATTTACTCCATCTCAGTTCCCCACCTTTGGTGGATTGAGCTTTCTGGATTCTCTTTTAAGGAAACTGAATGAGATGTCGACATCTAAGTCCGGATTAGGTTTCCTGATGAAACCTCTTTTAGGGAATTTGGAGAAAGAGCTATCATCTCTTACATCCATTTTAGAGAAGGAGCTCTCATCCATTTTCAGTGATGTCGTGCACCATGAACATAACATTCCTAAAGATCTTCAGAGACGTACCATCAATTTGGCATATGAGGCAGAGGTTGCTATTGATTCTATTCTTGCTCAGTATAATGCTTTTTTGCATATTTTTTGCTCACTTCCTACAATTGTAAAAGAGATCAAGCAAATTAATGTAGAGGTGACTGAGATGTGGTCAACGGACATTCCTCTTAATCCTCACTATGTGGCTGCTCCATTAAAACATCTGCCGGATCGACATAGCAATCTTGTAACTGATGAGGAGGTAGTGGGTTTTGAGAAACAAGCAGAAGAACTAATTGATTATCTGACTAGAGGTACAAATGAGCTAGACGTTGTCCCAATTGTAGGCATGGGAGGACAAGGGAAAACGACAATTGCTAGAAAGTTGTACAATAATGACATTATTGTTTCTCGCTTTGATGTTCGAGCATGGTGCATCATTTCTCAAACGTATAACCGGATAGAGTTATTACAAGATATTTTCAGTCAAGTTACAGGTTTCAACGACAATGGAGCTACGGTTGATGTTCTTGCCGACATGTTGAGGAGAAAATTAATGGGAAAGAGATATCTCATTGTATTGGATGATATGTGGGATTGTATGGTATGGGATGACTTAAGGCTTTCTTTTCCAGATGTTGGAATTAGAAGCAGAATAGTCGTAACAACTCGACTTGAAGAAGTGGGTAAGCAAGTCAAGTACCATACTGATCCTTATTCTCTTCCATTCCTCACAACAGAAGAGAGTTGCCAATTGTTGCAGAAAAAAGTGTTTCAAAAGGAAGATTGCCCGCTTGAACTACAAGATGTGAGTCAAGCAGTAGCAGAAAAATGCAAAGGACTGCCCCTAGTGGTTGTCTTGGTAGCTGGAATAATCAAAAAAAGGAAAATGGAAGAATCTTGGTGGAATGAGGTGAAAGATGCTTTATTTGACTATCTTGACAGTGAGTTCGAAGAATATAGTCTGGCGACTATGCAGTTGAGTTTTGATAACTTACCCCACTGTTTAAAGCCTTGTCTTCTTTATATGGGAATGTTTTCGGAGGACGCAAGAATTCCAGCATCTACATTGATAAGTTTATGGATTGCTGAAGGATTCGTGGAGAACACTGAATCTGGGAGATTAATGGAAGAGGAAGCTGAAGGTTACTTGATGGATCTCATTAGCAGTAACTTGGTAATGCTTTCAAAGAGAAGTTATAAGGGTAAAGTCAAATACTGTCAGGTTCATGATGTTGTGCATCACTTTTGCTTGGAAAAGAGTAGAGAAGCAAAGTTTATGCTTGCAGTGAAGGGTCAATGTATCCAGTTTCAACCTTCGGATTGGAAGGGAACTCGAGTGAGCTTCAGTTTTAGTGAAGAGCTTTCCAAGTTTGCATCTCTGGTCTCCAAAACACAGAAGCCTTTCCATCAACACTTGAGGTCATTGATAACGACCAATCGAGCAAAATCTATTGATGTGATTCTCTTCTGTCAGATTAGTGAATTGCGACTTCTTAAAGTCTTGGATTTGAGTTCTTATACTGTGGAGTTTTTGTCATTAGCTAAGTTCAAACCACTAAATCAGCTGAAGTACCTCGCAGTTAAGGCTGATAAATTCTATTTTGATCCAGGATCACATCTTCCCCATATAGAAACTTTCATTGTAAAGAATTTTTGTTATGGTATGGGGTTACCAGTGTCTTTTTGGGAAATGAAAAAATTAAGGCATGCTCATTTTGGTAATGCTGAATTTGATAAGCAGGGGCTCTTTGAAGGATCCTCTACATTGGAAAATTTGAGGATATTAAAGAATATTATTGGATTTGATGGGGTGGATGTGTTATCAAGGAGGTGTCCTAATCTTCAACAACTTCAAATCACATATTTTGGAAATGATGAAGAGCCTTTTACTCCCAAACTGGAGAATCTTACCCAGCTTCAACAACTTCAACTTTCCTTTGCGCGTCCCCACACTCTATCCGGGTTACAGTTGCCTTCAAATTTAAATAAGTTGGTACTTGAAGGAATTCATATAGAAAGTGTTATTTCCTTCATTGCGGGACTACCAAGCCTGGAATATCTCCAATTACAGGATGTGTGTTTTCCTCAATCAGAAGAGTGGTGCCTTGGAGATATCACGTTCCCTAAACTTAAGTTGTTGAAACTGGTGAACTTACCGATCTCAAGGTGGGATGTCTCAGAGGAATCATTTCCGTTGCTTGAAACATTCGTTATAAAGAAGTGCGATGACCTAGAGGAGATCCCACTTAGCTTTGTTGATATTCCAACATTGGAACAGATTAAATTGATTGGGTCCTGGAAAGTATCTCTGGAGGATTCAGCTGTGAGAATGAAGGAAGAAATCAAAGAGATTGAAGGATGTGATCGTTTACACCTCGTCAAACAACGCTATGATTGA


Protein sequences

Name Description Sequence
tospovirus resistance protein A tospovirus resistance protein A [Lycopersicon esculentum].

MAENEIEEMLEHLRRIKSGGDLDWLDILRIEELEMVLRVFRTFTKYHDVLLPDSLVELTKRAKLTGEILHRVLGRIPHKCKTNLNLERLESHLLEFFQGNTASLSHNYELNDFDLSKYMDCLENFLNDVLMMFLQKDRFFHSREQLAKHRSIKELKIVQKKIRFLKYIYATEINGYVDYEKQECLETRIQFMTNTVGQYCLAVLDYVTEGKLNEENDNFSKPPYLLSLIVLVELEMKKIFHGEVKASKFTQSKTFKDKKLPKGFSHHLHNLLMYLRNKKLENFPNNIAAQNIDVAIEFLLVFLDADVSNHVINGNWLKEVLLKVGAIAGDILYVIQKLLPRSINKDETSNISLCSIQILEKTKDLKAQVETYYKSLKFTPSQFPTFGGLSFLDSLLRKLNEMSTSKSGLGFLMKPLLGNLEKELSSLTSILEKELSSIFSDVVHHEHNIPKDLQRRTINLAYEAEVAIDSILAQYNAFLHIFCSLPTIVKEIKQINVEVTEMWSTDIPLNPHYVAAPLKHLPDRHSNLVTDEEVVGFEKQAEELIDYLTRGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWCIISQTYNRIELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRYLIVLDDMWDCMVWDDLRLSFPDVGIRSRIVVTTRLEEVGKQVKYHTDPYSLPFLTTEESCQLLQKKVFQKEDCPLELQDVSQAVAEKCKGLPLVVVLVAGIIKKRKMEESWWNEVKDALFDYLDSEFEEYSLATMQLSFDNLPHCLKPCLLYMGMFSEDARIPASTLISLWIAEGFVENTESGRLMEEEAEGYLMDLISSNLVMLSKRSYKGKVKYCQVHDVVHHFCLEKSREAKFMLAVKGQCIQFQPSDWKGTRVSFSFSEELSKFASLVSKTQKPFHQHLRSLITTNRAKSIDVILFCQISELRLLKVLDLSSYTVEFLSLAKFKPLNQLKYLAVKADKFYFDPGSHLPHIETFIVKNFCYGMGLPVSFWEMKKLRHAHFGNAEFDKQGLFEGSSTLENLRILKNIIGFDGVDVLSRRCPNLQQLQITYFGNDEEPFTPKLENLTQLQQLQLSFARPHTLSGLQLPSNLNKLVLEGIHIESVISFIAGLPSLEYLQLQDVCFPQSEEWCLGDITFPKLKLLKLVNLPISRWDVSEESFPLLETFVIKKCDDLEEIPLSFVDIPTLEQIKLIGSWKVSLEDSAVRMKEEIKEIEGCDRLHLVKQRYD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
383-873 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FPTFGGLSFLDSLLRKLNEMSTSKSGLGFLMKPLLGNLEKELSSLTSILEKELSSIFSDVVHHEHNIPKDLQRRTINLAYEAEVAIDSILAQYNAFLHIFCSLPTIVKEIKQINVEVTEMWSTDIPLNPHYVAAPLKHLPDRHSNLVTDEEVVGFEKQAEELIDYLTRGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWCIISQTYNRIELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRYLIVLDDMWDCMVWDDLRLSFPDVGIRSRIVVTTRLEEVGKQVKYHTDPYSLPFLTTEESCQLLQKKVFQKEDCPLELQDVSQAVAEKCKGLPLVVVLVAGIIKKRKMEESWWNEVKDALFDYLDSEFEEYSLATMQLSFDNLPHCLKPCLLYMGMFSEDARIPASTLISLWIAEGFVENTESGRLMEEEAEGYLMDLISSNLVMLSKRSYKGKVKYCQVHDVVHHFCLEKSREAKFM

HMMPanther: PTHR11017:SF126
383-873 PTHR11017:SF126,OS11G0237600 PROTEIN

FPTFGGLSFLDSLLRKLNEMSTSKSGLGFLMKPLLGNLEKELSSLTSILEKELSSIFSDVVHHEHNIPKDLQRRTINLAYEAEVAIDSILAQYNAFLHIFCSLPTIVKEIKQINVEVTEMWSTDIPLNPHYVAAPLKHLPDRHSNLVTDEEVVGFEKQAEELIDYLTRGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWCIISQTYNRIELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRYLIVLDDMWDCMVWDDLRLSFPDVGIRSRIVVTTRLEEVGKQVKYHTDPYSLPFLTTEESCQLLQKKVFQKEDCPLELQDVSQAVAEKCKGLPLVVVLVAGIIKKRKMEESWWNEVKDALFDYLDSEFEEYSLATMQLSFDNLPHCLKPCLLYMGMFSEDARIPASTLISLWIAEGFVENTESGRLMEEEAEGYLMDLISSNLVMLSKRSYKGKVKYCQVHDVVHHFCLEKSREAKFM

superfamily: SSF52540
516-763 SSF52540

APLKHLPDRHSNLVTDEEVVGFEKQAEELIDYLTRGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWCIISQTYNRIELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRYLIVLDDMWDCMVWDDLRLSFPDVGIRSRIVVTTRLEEVGKQVKYHTDPYSLPFLTTEESCQLLQKKVFQKEDCPLELQDVSQAVAEKCKGLPLVVVLVAGIIKKRKMEESWWNEVKDALFDYLDSEF

Gene3D: G3DSA:3.40.50.300
529-642 G3DSA:3.40.50.300

VTDEEVVGFEKQAEELIDYLTRGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWCIISQTYNRIELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRYLIVLDD

HMMPfam: PF00931
IPR002182
538-816 NB-ARC,NBS
NB-ARC

EKQAEELIDYLTRGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWCIISQTYNRIELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRYLIVLDDMWDCMVWDDLRLSFPDVGIRSRIVVTTRLEEVGKQVKYHTDPYSLPFLTTEESCQLLQKKVFQKEDCPLELQDVSQAVAEKCKGLPLVVVLVAGIIKKRKMEESWWNEVKDALFDYLDSEFEEYSLATMQLSFDNLPHCLKPCLLYMGMFSEDARIPASTLISLWIAEGFVENT

FPrintScan: PR00364
IPR000767
557-572 DISEASERSIST
Disease resistance protein

VVPIVGMGGQGKTTIA

FPrintScan: PR00364
IPR000767
630-644 DISEASERSIST
Disease resistance protein

KLMGKRYLIVLDDMW

FPrintScan: PR00364
IPR000767
724-738 DISEASERSIST
Disease resistance protein

CKGLPLVVVLVAGII

superfamily: SSF52058
854-1211 SSF52058,LRR

QVHDVVHHFCLEKSREAKFMLAVKGQCIQFQPSDWKGTRVSFSFSEELSKFASLVSKTQKPFHQHLRSLITTNRAKSIDVILFCQISELRLLKVLDLSSYTVEFLSLAKFKPLNQLKYLAVKADKFYFDPGSHLPHIETFIVKNFCYGMGLPVSFWEMKKLRHAHFGNAEFDKQGLFEGSSTLENLRILKNIIGFDGVDVLSRRCPNLQQLQITYFGNDEEPFTPKLENLTQLQQLQLSFARPHTLSGLQLPSNLNKLVLEGIHIESVISFIAGLPSLEYLQLQDVCFPQSEEWCLGDITFPKLKLLKLVNLPISRWDVSEESFPLLETFVIKKCDDLEEIPLSFVDIPTLEQIKLIG

Gene3D: G3DSA:3.80.10.10
926-1084 G3DSA:3.80.10.10

NRAKSIDVILFCQISELRLLKVLDLSSYTVEFLSLAKFKPLNQLKYLAVKADKFYFDPGSHLPHIETFIVKNFCYGMGLPVSFWEMKKLRHAHFGNAEFDKQGLFEGSSTLENLRILKNIIGFDGVDVLSRRCPNLQQLQITYFGNDEEPFTPKLENLT

FPrintScan: PR00364
IPR000767
940-956 DISEASERSIST
Disease resistance protein

SELRLLKVLDLSSYTVE

Gene3D: G3DSA:3.80.10.10
1085-1140 G3DSA:3.80.10.10

QLQQLQLSFARPHTLSGLQLPSNLNKLVLEGIHIESVISFIAGLPSLEYLQLQDVC


Diseases

Disease Pathogen Avirulence gene
Tomato Spotted Wilt Tomato spotted wilt virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox