PRGDB00000057 (Tm-2)

From PRG Wiki
Jump to: navigation, search
Tm-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 33621254 (AF536200)
Gene Class CNL
Domain Type NBS, LRR, LRR, Others
Chromosome 7
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum ToMV-resistance locus, Tm-2 resistance allele, complete cds.

DNA Sequence

ATGGCTGAAATTCTTCTTACATCAGTAATCAATAAATCTGTAGAAATAGCTGGAAATTTACTGATTCAAGAAGGAAAGCGTTTATATTGGTTGAAAGAGGATATCGATTGGCTCCAGAGAGAAATGAGACACATTCGATCTTATGTTGACAACGCAAAGGCCAAGGAAGCTGGAGGTGATTCAAGGGTCAAAAACTTATTGAAAGATATTCAAGAATTGGCAGGTGATGTGGAGGATCTCTTAGATGACTTCCTTCCAAAAATTCAACAATCCAATAAGTTCAATTATTGCCTTAAGAGGAGTTCTTTTGCGGATGAGTTTGCTATGGAGATTGAGAAGATAAAGAGAAGGGTTGTTGACATTGACCGAATAAGGAAAACTTACAACATCATAGATACAGATAACAATAATGATGATTGTGTTCTGCTGGATCGGAGAAGATTATTCCTACATGCTGATGAAACAGAGATCATCGGTTTGGATGATGACTTCAATATGCTACAAGCCAAATTACTTAATCAAGATTTGCATTATGGAGTTGTTTCCATAGTTGGCATGCCCGGTCTGGGGAAAACAACTCTTGCCAAGAAACTTTATAGGCTCATTCGTGATCAATTTGAGTGTTCTGGACTGGTCTACGTTTCACAACAGCCAAGAGCGAGTGAAATCTTACTTGACATTGCCAAACAAATTGGACTGACGGAACAGAAAATGAAGGAAAATTTGGAGGACAACCTGCGATCACTCTTGAAAATAAAAAGGTATGTTTTCCTCCTAGATGACATTTGGGATGTGGAAATTTGGGATGATCTGAAACTTGTCCTTCCTGAATGTGATTCAAAAGTCGGCAGTAGAATTATAATCACGTCTCGAAATAGTAATGTAGGCAGATACATAGGAGGGGAATCCTCCCTCCATGCATTGCAACCCCTAGAATCCGAGAAAAGCTTTGAACTCTTTACCAAGAAAATCTTTAATTTTGATGATAATAATAGTTGGGCCAATGCTTCACCTGACTTGGTGAATATTGGTAGAAATATAGTTGGGAGATGTGGAGGTATACCGCTAGCCATAGTGGTGACTGCAGGCATGTTAAGGGCAAGAGAAAGAACAGAACATGCGTGGAACAGAGTACTTGAGAGTATGGGCCATAAAGTTCAAGATGGATGTGCTAAGGTATTGGCTCTCAGTTACAATGATTTACCTATTGCCTCAAGGCCATGTTTCTTGTACTTTGGCCTTTACCCCGAGGACCATGAAATTCGTGCTTTTGATTTGATAAATATGTGGATTGCTGAGAAGTTTATAGTAGTAAATAGTGGTAATAGGCGAGAGGCTGAGGATTTGGCGGAGGACGTCCTAAATGATTTGGTTTCTAGAAACTTGATTCAACTTGCCAAAAGGACATATAATGGAAGAATTTCAAGTTGTCGCATACATGACTTGTTACATAGTTTGTGTGTGGACTTGGCTAAGGAAAGTAACTTCTTTCACACCGCGCATGATGCATTTGGTGATCCCGGCAATGTTGCTAGGCTCCGAAGGATTACATTCTACTCTGACAATGTCATGATTGAGTTCTTCCGTTCAAATCCTAAGCTTGAGAAGCTTCGTGTACTTTTCTGTTTCGCAAAAGACCCTTCCATATTTTCTCATATGGCTTATTTTGACTTCAAATTGTTGCACACATTGGTTGTAGTCATGTCTCAAAGTTTTCAAGCATATGTCACTATCCCAAGCAAATTTGGGAACATGACTTGCTTACGCTATCTGAGATTGGAGGGGAATATTTGTGGAAAACTGCCAAATAGTATTGTCAAGCTCACACGTCTAGAGACCATAGACATTGATCGACGTAGCCTCATTCAACCTCCTTCTGGTGTTTGGGAGTCTAAACATTTGAGACATCTTTGTTATAGAGATTATGGACAAGCATGTAACAGTTGCTTTTCTATAAGCTCATTTTACCCAAATATTTACTCATTGCATCCTAACAATCTACAAACCTTGATGTGGATACCTGATAAATTTTTTGAACCGAGGTTGTTGCACCGATTGATCAATTTAAGAAAACTGGGTATACTGGGAGTGTCCAATTCTACCGTTAAGATGTTATCAATATTTAGCCCTGTGCTCAAGGCGCTGGAGGTTCTGAAGCTCAGTTTTTCCAGTGACCCGAGTGAACAAATAAAGTTGTCATCGTATCCACATATTGCTAAGTTGCATTTGAATGTTAACAGAACAATGGCCTTGAACTCTCAATCATTTCCTCCAAATCTCATCAAGCTTACTCTAGCCAACTTTACGGTAGACCGTTATATACTGGCAGTACTTAAGACATTTCCCAAATTAAGAAAACTTAAAATGTTCATCTGCAAGTATAATGAAGAAAAGATGGATCTCTCGGGCGAGGCAAATGGTTATAGCTTTCCGCAACTTGAAGTTTTGCATATTCATAGCCCGAATGGGTTGTCTGAAGTAACGTGCACGGATGATGTCAGTATGCCCAAATTGAAAAAGCTGTTACTTACAGGATTCCATTGCCGAATCAGTTTATCGGAACGGCTTAAAAAGCTGAGTAAATGA


Protein sequences

Name Description Sequence
Tm-2 ToMV resistance protein Tm-2 ToMV resistance protein [Lycopersicon esculentum].

MAEILLTSVINKSVEIAGNLLIQEGKRLYWLKEDIDWLQREMRHIRSYVDNAKAKEAGGDSRVKNLLKDIQELAGDVEDLLDDFLPKIQQSNKFNYCLKRSSFADEFAMEIEKIKRRVVDIDRIRKTYNIIDTDNNNDDCVLLDRRRLFLHADETEIIGLDDDFNMLQAKLLNQDLHYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSNVGRYIGGESSLHALQPLESEKSFELFTKKIFNFDDNNSWANASPDLVNIGRNIVGRCGGIPLAIVVTAGMLRARERTEHAWNRVLESMGHKVQDGCAKVLALSYNDLPIASRPCFLYFGLYPEDHEIRAFDLINMWIAEKFIVVNSGNRREAEDLAEDVLNDLVSRNLIQLAKRTYNGRISSCRIHDLLHSLCVDLAKESNFFHTAHDAFGDPGNVARLRRITFYSDNVMIEFFRSNPKLEKLRVLFCFAKDPSIFSHMAYFDFKLLHTLVVVMSQSFQAYVTIPSKFGNMTCLRYLRLEGNICGKLPNSIVKLTRLETIDIDRRSLIQPPSGVWESKHLRHLCYRDYGQACNSCFSISSFYPNIYSLHPNNLQTLMWIPDKFFEPRLLHRLINLRKLGILGVSNSTVKMLSIFSPVLKALEVLKLSFSSDPSEQIKLSSYPHIAKLHLNVNRTMALNSQSFPPNLIKLTLANFTVDRYILAVLKTFPKLRKLKMFICKYNEEKMDLSGEANGYSFPQLEVLHIHSPNGLSEVTCTDDVSMPKLKKLLLTGFHCRISLSERLKKLSK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
6-496 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTSVINKSVEIAGNLLIQEGKRLYWLKEDIDWLQREMRHIRSYVDNAKAKEAGGDSRVKNLLKDIQELAGDVEDLLDDFLPKIQQSNKFNYCLKRSSFADEFAMEIEKIKRRVVDIDRIRKTYNIIDTDNNNDDCVLLDRRRLFLHADETEIIGLDDDFNMLQAKLLNQDLHYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSNVGRYIGGESSLHALQPLESEKSFELFTKKIFNFDDNNSWANASPDLVNIGRNIVGRCGGIPLAIVVTAGMLRARERTEHAWNRVLESMGHKVQDGCAKVLALSYNDLPIASRPCFLYFGLYPEDHEIRAFDLINMWIAEKFIVVNSGNRREAEDLAEDVLNDLVSRNLIQLAKRTYNGRISSCRIHDLLHSLCVDLAKESNF

HMMPanther: PTHR11017:SF126
6-496 PTHR11017:SF126,OS11G0237600 PROTEIN

LTSVINKSVEIAGNLLIQEGKRLYWLKEDIDWLQREMRHIRSYVDNAKAKEAGGDSRVKNLLKDIQELAGDVEDLLDDFLPKIQQSNKFNYCLKRSSFADEFAMEIEKIKRRVVDIDRIRKTYNIIDTDNNNDDCVLLDRRRLFLHADETEIIGLDDDFNMLQAKLLNQDLHYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSNVGRYIGGESSLHALQPLESEKSFELFTKKIFNFDDNNSWANASPDLVNIGRNIVGRCGGIPLAIVVTAGMLRARERTEHAWNRVLESMGHKVQDGCAKVLALSYNDLPIASRPCFLYFGLYPEDHEIRAFDLINMWIAEKFIVVNSGNRREAEDLAEDVLNDLVSRNLIQLAKRTYNGRISSCRIHDLLHSLCVDLAKESNF

superfamily: SSF52540
140-390 SSF52540

CVLLDRRRLFLHADETEIIGLDDDFNMLQAKLLNQDLHYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSNVGRYIGGESSLHALQPLESEKSFELFTKKIFNFDDNNSWANASPDLVNIGRNIVGRCGGIPLAIVVTAGMLRARERTEHAWNRVLESMGHKVQDGC

HMMPfam: PF00931
IPR002182
162-439 NB-ARC,NBS
NB-ARC

DDFNMLQAKLLNQDLHYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSNVGRYIGGESSLHALQPLESEKSFELFTKKIFNFDDNNSWANASPDLVNIGRNIVGRCGGIPLAIVVTAGMLRARERTEHAWNRVLESMGHKVQDGCAKVLALSYNDLPIASRPCFLYFGLYPEDHEIRAFDLINMWIAEKFIVVN

Gene3D: G3DSA:3.40.50.300
167-294 G3DSA:3.40.50.300

LQAKLLNQDLHYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSN

HMMSmart: SM00382
IPR003593
177-317 AAA,NBS
AAA+ ATPase domain

HYGVVSIVGMPGLGKTTLAKKLYRLIRDQFECSGLVYVSQQPRASEILLDIAKQIGLTEQKMKENLEDNLRSLLKIKRYVFLLDDIWDVEIWDDLKLVLPECDSKVGSRIIITSRNSNVGRYIGGESSLHALQPLESEKSF

FPrintScan: PR00364
IPR000767
180-195 DISEASERSIST
Disease resistance protein

VVSIVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
249-263 DISEASERSIST
Disease resistance protein

LLKIKRYVFLLDDIW

FPrintScan: PR00364
IPR000767
351-365 DISEASERSIST
Disease resistance protein

CGGIPLAIVVTAGML

superfamily: SSF52058
478-845 SSF52058,LRR

RIHDLLHSLCVDLAKESNFFHTAHDAFGDPGNVARLRRITFYSDNVMIEFFRSNPKLEKLRVLFCFAKDPSIFSHMAYFDFKLLHTLVVVMSQSFQAYVTIPSKFGNMTCLRYLRLEGNICGKLPNSIVKLTRLETIDIDRRSLIQPPSGVWESKHLRHLCYRDYGQACNSCFSISSFYPNIYSLHPNNLQTLMWIPDKFFEPRLLHRLINLRKLGILGVSNSTVKMLSIFSPVLKALEVLKLSFSSDPSEQIKLSSYPHIAKLHLNVNRTMALNSQSFPPNLIKLTLANFTVDRYILAVLKTFPKLRKLKMFICKYNEEKMDLSGEANGYSFPQLEVLHIHSPNGLSEVTCTDDVSMPKLKKLLLTG

Gene3D: G3DSA:3.80.10.10
523-631 G3DSA:3.80.10.10

VMIEFFRSNPKLEKLRVLFCFAKDPSIFSHMAYFDFKLLHTLVVVMSQSFQAYVTIPSKFGNMTCLRYLRLEGNICGKLPNSIVKLTRLETIDIDRRSLIQPPSGVWES

FPrintScan: PR00364
IPR000767
606-622 DISEASERSIST
Disease resistance protein

VKLTRLETIDIDRRSLI

Gene3D: G3DSA:3.80.10.10
687-845 G3DSA:3.80.10.10

INLRKLGILGVSNSTVKMLSIFSPVLKALEVLKLSFSSDPSEQIKLSSYPHIAKLHLNVNRTMALNSQSFPPNLIKLTLANFTVDRYILAVLKTFPKLRKLKMFICKYNEEKMDLSGEANGYSFPQLEVLHIHSPNGLSEVTCTDDVSMPKLKKLLLTG


Diseases

Disease Pathogen Avirulence gene
Tobacco Mosaic Virus Tomato mosaic virus PRGAV00000040




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox