PRGDB00000480 (Dm3 (RGC2B))

From PRG Wiki
Jump to: navigation, search
Dm3 (RGC2B)
Gene Type Reference_R-Genes,_manually_curated
GenBank 4106969 (AH007213)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Lactuca sativa

Comment?

Lactuca sativa resistance protein RGC2B (RGC2B) gene, complete cds.

DNA Sequence

ATGTCGGACCCAACGGGGATTGCTGGTGCCATTATTAACCCAATTGCTCAGACGGCCTTGGTTCCCGTTACGGACCATGTAGGCTACATGATTTCCTGCAGAAAATATGTGAGGGTCATGCAGATGAAAATGACAGAGTTGAATACCTCAAGAATCAGTGTAGAGGAACACATTAGCCGGAACACAAGAAATCATCTTCAGATTCCATCTCAAACTAAGGAATGGTTGGACCAAGTAGAAGGGATCAGAGCAAATGTGGAAAACTTTCCGATTGATGTCATCACTTGTTGTAGTCTCAGGATCAGGCACAAGCTTGGACAGAAAGCCTTCAAGATAACTGAGCAGATTGAAAGTCTAACGAGACAACTCTCCCTGATCAGTTGGACTGATGATCCAGTTCCTCTAGGAAGAGTTGGTTCCATGAATGCATCCACCTCTGCATCATTAAGTGATGATTTCCCATCAAGAGAGAAAACTTTTACACAAGCACTAAAAGCACTCGAACCCAACCAAAAATTCCACATGGTAGCCTTGTGTGGGATGGGTGGAGTGGGGAAGACTAGAATGATGCAAAGGCTGAAGAAGGCTGCTGAAGAAAAGAAATTGTTTAATTATATTGTTGGGGCAGTTATAGGGGAAAAGACGGACCCCTTTGCCATTCAAGAAGCTATAGCAGATTACCTCGGTATACAACTCAATGAAAAAACTAAGCCAGCAAGAGCTGATAAGCTTCGTGAATGGTTCAAAAAGAATTCAGATGGAGGTAAGACTAAGTTCCTCATAGTACTTGACGATGTTTGGCAATTAGTTGATCTTGAAGATATTGGGTTAAGTCCTTTTCCAAATCAAGGTGTCGACTTCAAGGTCTTGTTGACATCACGAGACTCACAAGTTTGCACTATGATGGGGGTTGAAGCTAATTCAATTATTAACGTGGGCCTTCTAACTGAAGCAGAAGCTCAAAGTCTGTTCCAACAATTTGTAGAAACTTCTGAGCCCGAGCTCCAGAAGATAGGAGAGGATATCGTAAGGAAGTGTTGCGGTCTACCTATTGCCATAAAAACCATGGCATGTACTCTTAGAAATAAAAGAAAGGATGCATGGAAGGATGCACTTTCGCGCATAGAGCACTATGACATTCACAATGTTGCGCCCAAAGTCTTTGAAACGAGCTACCACAATCTCCAAGAAGAGGAGACTAAATCCACTTTTTTAATGTGTGGTTTGTTTCCCGAAGACTTCGATATTCCTACTGAGGAGTTGATGAGGTATGGATGGGGCTTGAAGCTATTTGATAGAGTTTATACGATTAGAGAAGCAAGAACCAGGCTCAACACCTGCATTGAGCGACTGGTGCAGACAAATTTGTTAATTGAAAGTGATGATGTTGGGTGTGTCAAGATGCATGATCTGGTCCGTGCTTTTGTTTTGGGTATGTTTTCTGAAGTCGAGCATGCTTCTATTGTCAACCATGGTAATATGCCTGGGTGGCCTGATGAAAATGATATGATCGTGCACTCTTGCAAAAGAATTTCATTAACATGCAAGGGTATGATTGAGATTCCAGTAGACCTCAAGTTTCCTAAACTAACGATTTTGAAACTTATGCATGGAGATAAGTCGCTAAGGTTTCCTCAAGACTTTTATGAAGGAATGGAAAAGCTCCATGTTATATCATACGATAAAATGAAGTACCCATTGCTTCCTTTGGCACCTCGATGCTCCACCAACATTCGGGTGCTTCATCTCACTGAATGTTCATTAAAGATGTTTGATTGCTCTTCTATCGGAAATCTATCGAATCTGGAAGTGCTGAGCTTTGCAAATTCTCACATTGAATGGTTACCTTCCACAGTCAGAAATTTAAAGAAGCTAAGGTTACTTGATCTGAGATTTTGTGATGGTCTCCGTATAGAACAGGGTGTCTTGAAAAGTTTTGTCAAACTTGAAGAATTTTATATTGGAGATGCATCTGGGTTTATAGATGATAACTGCAATGAGATGGCAGAGCGTTCTTACAACCTTTCTGCATTAGAATTCGCGTTCTTTAATAACAAGGCTGAAGTGAAAAATATGTCATTTGAGAATCTTGAACGATTCAAGATCTCAGTGGGATGCTCTTTTGATGAAAATATCAATATGAGTAGCCACTCATACGAAAACATGTTGCAATTGGTGACCAACAAAGGTGATGTATTAGACTCTAAACTTAATGGGTTATTTTTGAAAACAGAGGTGCTTTTTTTAAGTGTGCATGGCATGAATGATCTTGAAGATGTTGAGGTGAAGTCGACACATCCTACTCAGTCCTCTTCATTCTGCAATTTAAAAGTTCTTATTATTTCAAAGTGTGTAGAGTTGAGATACCTTTTCAAACTCAATCTTGCAAACACTTTGTCAAGACTTGAGCATCTAGAAGTTTGTGAATGTGAGAATATGGAAGAACTCATACATACTGGAATTGGGGGTTGTGGAGAAGAGACAATTACTTTCCCTAAGCTGAAGTTTTTATCTTTGAGTCAACTACCGAAGTTATCAAGTTTGTGCCATAATGTCAACATAATTGGGCTACCACATCTCGTAGACTTGATACTTAAGGGCATTCCAGGTTTCACAGTCATTTATCCGCAGAACAAGTTGCGAACATCTAGTTTGTTGAAGGAAGGGGTTGTGATTCCTAAGTTGGAGACACTTCAAATTGATGACATGGAGAACTTAGAAGAAATATGGCCTTGTGAACTTAGTGGAGGTGAGAAAGTTAAGTTGAGAGCGATTAAAGTGAGTAGCTGTGATAAGCTTGTGAATCTATTTCCGCGCAATCCCATGTCTCTGTTGCATCATCTTGAAGAGCTTACAGTCGAGAATTGCGGTTCCATTGAGTCGTTATTCAACATTGACTTGGATTGTGTCGGTGCAATTGGAGAAGAAGACAACAAGAGCCTCTTAAGAAGCATCAACGTGGAGAATTTAGGGAAGCTAAGAGAGGTGTGGAGGATAAAAGGTGCAGATAACTCTCATCTCATCAACGGTTTTCAAGCTGTTGAAAGCATAAAGATTGAAAAATGTAAGAGGTTTAGAAATATATTCACACCTATCACCGCCAATTTTTATCTGGTGGCACTTTTGGAGATTCAGATAGAAGGTTGCGGAGGAAATCACGAATCAGAAGAGCAGATTGAAATTCTATCAGAGAAAGAGACATTACAAGAAGCCACTGGCAGTATTTCAAATCTTGTATTCCCATCCTGTCTCATGCACTCTTTTCATAACCTCCGTGTGCTTACATTGGATAATTATGAAGGAGTGGAGGTGGTATTTGAGATAGAGAGTGAGAGTCCAACATGTAGAGAATTGGTAACAACTCGCAATAACCAACAACAGCCTATTATACTTCCCTACCTCCAGGATTTGTATCTAAGGAATATGGACAACACGAGTCATGTGTGGAAGTGCAGCAACTGGAATAAATTCTTCACTCTTCCAAAACAACAATCAGAATCCCCATTCCACAACCTCACAACCATAAATATTCTTAAATGCAAAAGCATTAAGTACTTGTTTTCGCCTCTCATGGCAGAACTTCTTTCCAACCTAAAGGATATCCGGATAAGTGAGTGTGATGGTATTAAAGAAGTTGTTTCAAACAGAGATGATGAGGATGAAGAAATGACTACATTTACATCTACCCACACAACCACCACTTTGTTCCCTAGTCTTGATTCTCTCACTCTAAGTTTCCTGGAGAATCTGAAGTGTATTGGTGGAGGTGGTGCCAAGGATGAGGGGAGCAATGAAATATCTTTCAATAATACCACTGCAACTACTGCTGTTCTTGATCAATTTGAGTTGTCTGAAGCAGGTGGTGTTTCTTGGAGTTTATGCCAATACGCTAGAGAGATAGAAATAGTTGGATGCTATGCATTGTCAAGTGTGATTCCATGTTATGCAGCAGGACAAATGCAAAAGCTTCAAGTGCTGAGAATAGAGTCTTGTGATGGCATGAAGGAGGTATTTGAAACTCAATTAGGGACGAGCAGCAACAAAAACAACGAGAAGAGTGGTTGCGAGGAAGGAATTCCAAGAGTAAATAACAATGTTATTATGCTTCCCAATCTAAAGATATTAAGTATTGGAAATTGTGGGGGTTTGGAACATATATTCACATTCTCTGCACTTGAAAGCCTGAGACAGCTCCAAGAGTTAAAGATAAAATTTTGCTACGGAATGAAAGTGATTGTGAAGAAGGAAGAAGATGAATATGGAGAGCAGCAAACAACAACAACAACAACGAAGGGGGCATCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTAAGAAGGTTGTGGTCTTTCCTTGTCTAAAGTCCATTGTATTGGTCAATCTACCAGAGCTGGTAGGATTCTTCTTGGGGATGAATGAGTTCCGGTTGCCTTCATTAGATAAACTTAAGATCAAGAAATGCCCAAAAATGATGGTGTTTACAGCTGGTGGGTCCACAGCTCCCCAACTCAAGTATATACACACAAGATTAGGCAAACATACTCTTGATCAAGAATCTGGCCTTAACTTTCATCAGACCTCATTCCAAAGTTTATACGGTGACACCTTGGGCCCTGCTACTTCAGAAGGGACAACTTGGTCTTTTCATAACTTTATCGAATTAGATGTGGAAGGTAATCATGATGTTAAAAAGATTATTCCATCCAGTGAGTTGCTGCAACTGCAAAAGCTGGAAAAGATTAATGTAAGGTGGTGTAAAAGGGTAGAGGAGGTATTTGAAACTGCATTGGAAGCAGCAGGGAGAAATGGAAATAGTGGAATTGGTTTTGATGAATCGTCACAAACAACTACCACTACTCTTGTCAATCTTCCAAACCTTAGAGAAATGAACTTATGGGGTCTAGATTGTCTGAGGTATATATGGAAGAGCAATCAGTGGACAGCATTTGAGTTTCCAAACCTAACAAGAGTTGATATCTATAAATGTAAAAGGTTAGAACATGTATTTACTAGTTCCATGGTTGGTAGTCTATCGCAACTCCAAGAGCTACATATATCCAACTGCAGTGAGATGGAGGAGGTGATTGTTAAGGATGCAGATGATTCTGTAGAAGAAGACAAAGAGAAAGAATCTGATGGGGAGACGAATAAGGAGATACTTGTGTTACCTCGTCTAAACTCCTTGATATTAAGAGAACTTCCATGTCTTAAGGGGTTTAGCTTGGGGAAGGAGGATTTTTCATTCCCATTATTGGATACTTTAAGAATTGAGGAATGCCCAGCAATAACCACCTTCACCAAGGGAAATTCCGCTACTCCACAGCTAAAAGAAATTGAAACACATTTTGGCTCGTTTTGTGCTGCAGGGGAAAAAGACATCAACTCTCTTATAAAGATCAAACAACAGGAGTTCAAACAAGACTCTGATTAA


Protein sequences

Name Description Sequence
resistance protein candidate RGC2B [Lactuca sativa] - candidate for Dm3 resistance protein candidate RGC2B [Lactuca sativa]

MSDPTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQMKMTELNTSRISVEEHISRNTRNHLQIPS

QTKEWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGS MNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAV IGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPF PNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLP IAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEE LMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVN HGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISY DKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDL RFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERF KISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQS SSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLS QLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIW PCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKS LLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCG GNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVT TRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPL MAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKD EGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIES CDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQE LKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFL GMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPA TSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGF DESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQ LQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFP

LLDTLRIEECPAITTFTKGNSATPQLKEIETHFGSFCAAGEKDINSLIKIKQQEFKQDSD

resistance protein candidate RGC2B

MSDPTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQMKMTELNTSRISVEEHISRNTRNHLQIPSQTKEWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGSMNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEELMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVNHGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERFKISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIWPCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKSLLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVTTRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKDEGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIESCDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQELKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFLGMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPATSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGFDESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQLQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFPLLDTLRIEECPAITTFTKGNSATPQLKEIETHFGSFCAAGEKDINSLIKIKQQEFKQDSD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-1780 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQMKMTELNTSRISVEEHISRNTRNHLQIPS

QTKEWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGS MNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAV IGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPF PNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLP IAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEE LMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVN HGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISY DKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDL RFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERF KISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQS SSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLS QLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIW PCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKS LLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCG GNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVT TRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPL MAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKD EGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIES CDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQE LKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFL GMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPA TSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGF DESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQ LQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFP

LLDTL

HMMPanther: PTHR23155:SF121
4-1780 PTHR23155:SF121,SUBFAMILY NOT NAMED

PTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQMKMTELNTSRISVEEHISRNTRNHLQIPS

QTKEWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGS MNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAV IGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPF PNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLP IAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEE LMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVN HGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISY DKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDL RFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERF KISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQS SSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLS QLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIW PCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKS LLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCG GNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVT TRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPL MAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKD EGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIES CDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQE LKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFL GMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPA TSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGF DESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQ LQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFP

LLDTL

HMMPanther: PTHR23155
4-1780 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQMKMTELNTSRISVEEHISRNTRNHLQIPSQTKEWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGSMNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEELMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVNHGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERFKISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIWPCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKSLLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVTTRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKDEGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIESCDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQELKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFLGMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPATSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGFDESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQLQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFPLLDTLRIEECPAITTFTKGNSATPQLKEIE

HMMPanther: PTHR23155:SF121
4-1780 PTHR23155:SF121,SUBFAMILY NOT NAMED

PTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQMKMTELNTSRISVEEHISRNTRNHLQIPSQTKEWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGSMNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEELMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVNHGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERFKISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIWPCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKSLLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVTTRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKDEGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIESCDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQELKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFLGMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPATSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGFDESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQLQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFPLLDTLRIEECPAITTFTKGNSATPQLKEIE

superfamily: SSF52540
136-383 SSF52540

LGRVGS

MNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAV IGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPF PNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLP

IAIKTMACTLRNKRKDAWKDALSRIEHY

superfamily: SSF52540
136-383 SSF52540

GRVGSMNASTSASLSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNV

Gene3D: G3DSA:3.40.50.300
151-274 G3DSA:3.40.50.300

LSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAV IGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVD

Gene3D: G3DSA:3.40.50.300
151-274 G3DSA:3.40.50.300

DDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLED

HMMPfam: PF00931
IPR002182
157-424 NB-ARC,NBS
NB-ARC

SREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAV

IGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPF PNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLP

IAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTE

HMMPfam: PF00931
IPR002182
157-424 NB-ARC,NBS
NB-ARC

EKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEELMRY

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

FHMVALCGMGGVGKTR

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

MVALCGMGGVGKTRMM

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

KNSDGGKTKFLIVLD

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

DGGKTKFLIVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

IVRKCCGLP IAIKT

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CCGLPIAIKTMACTL

superfamily: SSF52058
467-1050 SSF52058,LRR

DDVGCVKMHDLVRAFVLGMFSEVEHASIVN

HGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISY DKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDL RFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERF KISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQS SSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLS QLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIW PCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKS

LLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANF

superfamily: SSF52058
467-1050 SSF52058,LRR

KMHDLVRAFVLGMFSEVEHASIVNHGNMPGWPDENDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSFVKLEEFYIGDASGFIDDNCNEMAERSYNLSALEFAFFNNKAEVKNMSFENLERFKISVGCSFDENINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTEVLFLSVHGMNDLEDVEVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEGVVIPKLETLQIDDMENLEEIWPCELSGGEKVKLRAIKVSSCDKLVNLFPRNPMSLLHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKSLLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCG

Gene3D: G3DSA:3.80.10.10
508-657 G3DSA:3.80.10.10

NDMIVHSCKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISY

DKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDL

RFCDGLRIEQGVLKSFVK

Gene3D: G3DSA:3.80.10.10
508-657 G3DSA:3.80.10.10

CKRISLTCKGMIEIPVDLKFPKLTILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTECSLKMFDCSSIGNLSNLEVLSFANSHIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSFVKLEEFYIGDA

FPrintScan: PR00364
IPR000767
620-636 DISEASERSIST
Disease resistance protein

IEWLPSTVRNLKKLRLL

FPrintScan: PR00364
IPR000767
620-636 DISEASERSIST
Disease resistance protein

RNLKKLRLLDLRFCDGL

Gene3D: G3DSA:3.80.10.10
761-866 G3DSA:3.80.10.10

VHGMNDLEDVEVKSTHPTQS

SSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLS

QLPKLSSLCHNVNI

Gene3D: G3DSA:3.80.10.10
761-866 G3DSA:3.80.10.10

EVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGIGGCGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILK

superfamily: SSF52047
958-1213 SSF52047,LRR

LHHLEELTVENCGSIESLFNIDLDCVGAIGEEDNKS

LLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCG GNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVT TRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPL

MAELLS

superfamily: SSF52047
958-1213 SSF52047,LRR

SIESLFNIDLDCVGAIGEEDNKSLLRSINVENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFRNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEATGSISNLVFPSCLMHSFHNLRVLTLDNYEGVEVVFEIESESPTCRELVTTRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGIKEVV

Gene3D: G3DSA:3.80.10.10
1133-1209 G3DSA:3.80.10.10

LVT

TRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPL

MA

Gene3D: G3DSA:3.80.10.10
1133-1209 G3DSA:3.80.10.10

YLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGI

superfamily: SSF52047
1299-1586 SSF52047,LRR

FELSEAGGVSWSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIES

CDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQE LKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFL GMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPA

TSEGTTWSFHNFIELDVEGNHDVK

superfamily: SSF52047
1299-1586 SSF52047,LRR

EIEIVGCYALSSVIPCYAAGQMQKLQVLRIESCDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQELKIKFCYGMKVIVKKEEDEYGEQQTTTTTTKGASSSSSSSSSSSSKKVVVFPCLKSIVLVNLPELVGFFLGMNEFRLPSLDKLKIKKCPKMMVFTAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTLGPATSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWC

Gene3D: G3DSA:3.80.10.10
1309-1408 G3DSA:3.80.10.10

WSLCQYAREIEIVGCYALSSVIPCYAAGQMQKLQVLRIES CDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTF

Gene3D: G3DSA:3.80.10.10
1309-1408 G3DSA:3.80.10.10

SSVIPCYAAGQMQKLQVLRIESCDGMKEVFETQLGTSSNKNNEKSGCEEGIPRVNNNVIMLPNLKILSIGNCGGLEHIFTFSALESLRQLQELKIKFCYG

Gene3D: G3DSA:3.80.10.10
1536-1633 G3DSA:3.80.10.10

TLDQESGLNFHQTSFQSLYGDTLGPA TSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGF

Gene3D: G3DSA:3.80.10.10
1536-1633 G3DSA:3.80.10.10

TLGPATSEGTTWSFHNFIELDVEGNHDVKKIIPSSELLQLQKLEKINVRWCKRVEEVFETALEAAGRNGNSGIGFDESSQTTTTTLVNLPNLREMNLW

superfamily: SSF52047
1623-1779 SSF52047,LRR

GRNGNSGIGF

DESSQTTTTTLVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQ LQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFP

LLDT

superfamily: SSF52047
1623-1779 SSF52047,LRR

NLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQLQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFPLLDTLRIEECPAITTFTKGNSATPQLKEI

Gene3D: G3DSA:3.80.10.10
1644-1768 G3DSA:3.80.10.10

LVNLPNLREMNLWGLDCLRYIWKSNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQ LQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGK

Gene3D: G3DSA:3.80.10.10
1644-1768 G3DSA:3.80.10.10

SNQWTAFEFPNLTRVDIYKCKRLEHVFTSSMVGSLSQLQELHISNCSEMEEVIVKDADDSVEEDKEKESDGETNKEILVLPRLNSLILRELPCLKGFSLGKEDFSFPLLDTLRIEECPAITTFTK


Diseases

Disease Pathogen Avirulence gene
Downy mildew lettuce Saccharum officinarum PRGAV00000041

List of References

B C Meyers, D B Chin, K A Shen, S Sivaramakrishnan, D O Lavelle, Z Zhang, R W Michelmore
The major resistance gene cluster in lettuce is highly duplicated and spans several megabases.
Plant Cell: 1998, 10(11);1817-32
PubMed:9811791 WorldCat.org (P p)

B C Meyers, K A Shen, P Rohani, B S Gaut, R W Michelmore
Receptor-like genes in the major resistance locus of lettuce are subject to divergent selection.
Plant Cell: 1998, 10(11);1833-46
PubMed:9811792 WorldCat.org (P p)

B C Meyers, D B Chin, K A Shen, S Sivaramakrishnan, D O Lavelle, Z Zhang, R W Michelmore
The major resistance gene cluster in lettuce is highly duplicated and spans several megabases.
Plant Cell: 1998, 10(11);1817-32
PubMed:9811791 WorldCat.org (P p)

B C Meyers, K A Shen, P Rohani, B S Gaut, R W Michelmore
Receptor-like genes in the major resistance locus of lettuce are subject to divergent selection.
Plant Cell: 1998, 10(11);1833-46
PubMed:9811792 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox