PRGDB00000481 (At1)

From PRG Wiki
Jump to: navigation, search
At1
Gene Type Reference_R-Genes,_manually_curated
GenBank 18032027 (AY066012)
Gene Class Other
Domain Type Ser-Thr Kinase
Gene Species Cucumis melo

Comment?

Cucumis melo aminotransferase 1 mRNA, complete cds.

DNA Sequence

ATGGATTACGTTTATGCACCTGGAAAGAACCATCTCTTTGTCCCAGGGCCGGTCAACATTCCCGAACCGGTTCTGCGGGCAATGAACCGAAACAATGAGGATTATCGTTCGCCTGCCGTTCCTGCTTTGACGAAAACTCTTCTTGAAGATGTGAAAAAGATTTTCAAATCTACTACTGGAACCACATTCCTGATTCCCACAACAGGTACTGGTGCTTGGGAAAGTGCTCTTACAAACACATTGTCTCCTGGAGATAGGATCGTGTCCTTTCTCATTGGCCAGTTCAGTCTGCTCTGGATTGATCAGCAGCAGCGCCTTAACTTCAACGTCGATGTCGTCGAGAGCGACTGGGGTCAGGGTGCCAATCTTGATGTTCTGGAATCAAAGCTTGCCACCGATGGCGGCCACACCATCAAGGCAATTTGCATTGTCCACAATGAGACAGCTACTGGTGTCACTAATGACCTGTCTAAAGTTCGGTTCCTACTTGATAAGTACAAGCATCCTGCTCTTTTGCTGGTCGACGGAGTGTCATCCATATGTGCACTTGATTTTCGAATGGATGAATGGGGAGTCGACGTTGCTTTAACTGGTTCCCAAAAGGCTCTTTCTCTCCCTACAGGACTTGGAATTATTTGTGCCAGTCCCAAAGCACTAGAAGCATCCAAAACTTCAAAATCTGTCAAAGTCTTCTTTGATTGGAAAGACTATCTCAAATTCTACAATCTAGGAACATACTGGCCATACACCCCTTCCATTCAGCTCTTGTATGGATTAAGAGCAGCTCTCGATCTTCTTTTCGAGGAAGGTTTGGACAATGTGATTGCTCGGCACAGTCGTCTTGGCAAAGCAACAAGGCTTGCTGTGGAGGCTTGGGGGTTGAAAAATTGTACACAAAAAGAGGAATGGTTTAGTGACACTGTTACTGCTGTGCTTGTTCCTTCTTACATTGACAGTGCAGAAATTGTGAGAAGGGCATGGAAGAGATACAATTTGAGCTTGGGACTTGGCCTTAACAAAGTTGCTGGCAAAGTATTCAGAATTGGTCACCTTGGAAACCTTAATGAGTTGCAACTGTTGGGATGTCTTGCTGGTGTAGAAATGGTACTGAAGGATGTCGGGTACCCTGTTAAACTAGGGAGTGGAGTTGCTGCAGCTAGTGCATATCTTCAAAATAACATCCCTCTCATTCCTTCAAGGATTTAA


Protein sequences

Name Description Sequence
aminotransferase 1 aminotransferase 1 [Cucumis melo].

MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152
1-401 PTHR21152,AMINOTRANSFERASE CLASS V

MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI

HMMPanther: PTHR21152:SF7
1-401 PTHR21152:SF7,SUBFAMILY NOT NAMED

MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI

HMMPIR: PIRSF000524
IPR024169
3-396 SPT
Serine-pyruvate aminotransferase/2-aminoethylphosp

YVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPL

superfamily: SSF53383
IPR015424
7-377 PyrdxlP-dep_Trfase_major
Pyridoxal phosphate-dependent transferase, major d

PGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPV

HMMPfam: PF00266
IPR000192
12-323 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIV

Gene3D: G3DSA:3.40.640.10
IPR015421
21-257 PyrdxlP-dep_Trfase_major_sub1
Pyridoxal phosphate-dependent transferase, major r

PEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTGTTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLY

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGII

Gene3D: G3DSA:3.90.1150.10
IPR015422
258-383 PyrdxlP-dep_Trfase_major_sub2
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGV


Diseases

Disease Pathogen Avirulence gene
Downy mildew mellon

List of References

Dvir Taler, Marjana Galperin, Ido Benjamin, Yigal Cohen, David Kenigsbuch
Plant eR genes that encode photorespiratory enzymes confer resistance against disease.
Plant Cell: 2004, 16(1);172-84
PubMed:14688292 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox