PRGDB00000484 (HRT)

From PRG Wiki
Jump to: navigation, search
HRT
Gene Type Reference_R-Genes,_manually_curated
GenBank 7110564 (AF234174)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, NBS, Ser-Thr Kinase, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana viral resistance protein (HRT) gene, complete cds.

DNA Sequence

ATGGCTGAAGCATTTGTGTCGTTTGGACTTGAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGAGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGTTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAACTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGAGGAGAAGAAAAAGGGATCAAGAAGCATGTGAGACGACTTGCTTGCTTTTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAGAGGATCTCTGAGGTGATTGGGGAAATGCAGAGTTTAGGGATACAACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGTGCAGAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAAAGCGATCTTGTCGGGGTGGAGCAGAGTGTTACAGAATTGGTTTGTCATTTGGTGGAGAATGATGTTCATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGTAAAACCACTCTGGCTAGACAAGTCTTTCATCATGATTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCGCAACAATTTACACAGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGGATATTTTACAGATGGACGAATCTGCACTTCAGCCTAAACTCTTTCAATTGTTAGAGACCGGTAGATACTTACTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATCGAATAAAAGCAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTGCTTACTTCTCGAAATGAAGGTGTTGGGATACATGCTGATCCAACATGTTTAACTTTTAGAGCAAGCATCCTTAACCCTGAAGAAAGTTGGAAGCTCTGTGAGAGAATAGTATTCCCTAGGAGAGATGAAACTGAAGTAAGGCTTGATGAAGAAATGGAAGCCATGGGAAAGGAAATGGTCACACATTGTGGAGGACTACCATTAGCTGTTAAAGTGTTGGGAGGCTTGTTAGCTAATAAACATACAGTTCCTGAGTGGAAAAGAGTTTCTGACAATATTGGATCTCAAATAGTAGGAGGATCGTGCTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTCTGAGTTATGAAGATTTGCCAACGCATTTAAAGCATCGCTTCCTTTTCCTAGCCCATTTCCCCGAAGATTCCAAGATTACAACGCAGGAGTTGTTCTATTACTGGGCTGCAGAAGGGATTTACGATGGATCAACCATCGAAGATAGTGGAGAATACTACCTAGAAGAGCTAGTGAGGAGAAATTTGGTTATTGCAGACAACAAGTATTTGAGAGTTCACTCTAAATATTGTCAAATGCATGACATGATGAGAGAAGTATGTTTATCTAAAGCCAAAGAAGAGAACTTCCTTCAAATTATCAAAGACCCTACTTCCATCTCTACCATCAATGCTCAATCTCCTCGTAGATCTCGCAGACTCAGCATACATCGTGGTAAAGCCTTTCAAATATTGGGACACAGAAACAATGCAAAGGTGAGATCTCTTATAGTTTCGAGATTCAAGGAGGAAGACTTTTGGATACGATCAGCTTCAGTCTTCCACAACTTAACATTGCTCAGGGTGTTGGATCTTTCTTGGGTAAAGTTTGAAGGAGGGAAATTACCTTCTAGCATTGGAGGGCTCATCCACTTGAGATACTTGAGTTTATACGAGGCTAAGGTATCTCATCTACCTTCTACTATGCGGAACTTAAAGCTTCTGCTCTATTTGGACTTAAGTGTTCATGAGGAGGAACCGATTCACGTGCCAAATGTTTTGAAAGAGATGATAGAGTTGAGGCACATTTCCCTACCTCTAATGGATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTTTCGTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACTAAGCTCCAGTATCTCGGTGTATCTTTGAGCGAAAGGTGCAATTTTGAAACTCTATCGTCATCTCTCCGTGAATTGCGAAACCTCGAGTCGCTTAATTTCCTTTTTACGCCCGAAACCTATATGGTTGATTATATGGGAGAGTTTGTTCTGGATCATTTTATTCATCTAAAAGAGTTGGGATTGGCAGTACGTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTACCCACATACATCTATTGTTTTGCCGCATGGAAGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATTTGAAGTCGGTTCAATTGACAGATGAGGCTTTCGTTGGAAGCAGAATGGTGTGCTCAAAAGGTGGGTTTCCTCAATTATGTGCTCTAGACATATCTAAAGAATCAGAATTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTTTGACTATACATGATTGCGAAAAGTTGAAGGAACTTCCAGATGGACTCAAGTACATAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAACTGGTACCAGGTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTATCAACTGTGACCAGTAG


Protein sequences

Name Description Sequence
viral resistance protein viral resistance protein [Arabidopsis thaliana].

MAEAFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEEKGIKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSLGIQQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADNKYLRVHSKYCQMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ

viral resistance protein viral resistance protein [Arabidopsis thaliana].

MAEAFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEEKGIKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSLGIQQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADNKYLRVHSKYCQMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-908 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEEKGIKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSLGIQQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADNKYLRVHSKYCQMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

HMMPanther: PTHR23155
2-908 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEEKGIKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSLGIQQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADNKYLRVHSKYCQMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

HMMPanther: PTHR23155
2-908 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEEKGIKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSLGIQQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADNKYLRVHSKYCQMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

HMMPanther: PTHR23155:SF231
2-908 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEEKGIKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSLGIQQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADNKYLRVHSKYCQMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

Coil: coil
17-52 coiled-coil

LSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKK

Coil: coil
17-52 coiled-coil

LSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKK

Seg: seg
34-46 seg

LKRQLRSLQSLLK

Seg: seg
34-46 seg

LKRQLRSLQSLLK

Seg: seg
145-156 seg

QERQRVQREIRQ

Seg: seg
145-156 seg

QERQRVQREIRQ

superfamily: SSF52540
149-397 P-loop containing nucleoside triphosphate hydrolases

RVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVG

superfamily: SSF52540
149-397 P-loop containing nucleoside triphosphate hydrolases

RVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVG

HMMPfam: PF00931
IPR002182
170-456 NB-ARC,NBS
NB-ARC

EQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYD

HMMPfam: PF00931
IPR002182
170-456 NB-ARC,NBS
NB-ARC

EQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKVLGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHRFLFLAHFPEDSKITTQELFYYWAAEGIYD

Gene3D: G3DSA:3.40.50.300
173-290 no description

VTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFP

Gene3D: G3DSA:3.40.50.300
173-290 no description

VTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFP

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

LLETGRYLLVLDDVW

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

LLETGRYLLVLDDVW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CGGLPLAVKVLGGLL

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CGGLPLAVKVLGGLL

superfamily: SSF52058
492-877 L domain-like,LRR

QMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEG

superfamily: SSF52058
492-877 L domain-like,LRR

QMHDMMREVCLSKAKEENFLQIIKDPTSISTINAQSPRRSRRLSIHRGKAFQILGHRNNAKVRSLIVSRFKEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPSSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLDLSVHEEEPIHVPNVLKEMIELRHISLPLMDDKTKLELGDLVNLEYLFRFSTQHSSVTDLLRMTKLQYLGVSLSERCNFETLSSSLRELRNLESLNFLFTPETYMVDYMGEFVLDHFIHLKELGLAVRMSKIPDQHQFPPHLTHIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEG

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

HNLTLLRVLDLSWVKFE

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

HNLTLLRVLDLSWVKFE

Seg: seg
713-730 seg

LSSSLRELRNLESLNFLF

Seg: seg
713-730 seg

LSSSLRELRNLESLNFLF

Gene3D: G3DSA:3.80.10.10
775-877 no description

HIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEG

Gene3D: G3DSA:3.80.10.10
775-877 no description

HIHLLFCRMEEDPMPILEKLLHLKSVQLTDEAFVGSRMVCSKGGFPQLCALDISKESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEG


Diseases

Disease Pathogen Avirulence gene
Turnip crinkle virus Turnip crinkle virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox