PRGDB00000487 (M)

From PRG Wiki
Jump to: navigation, search
M
Gene Type Reference_R-Genes,_manually_curated
GenBank 1842250 (U73916)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Gene Species Linum usitatissimum

Comment?

Linum usitatissimum rust resistance protein M gene, complete cds.

DNA Sequence

ATGAGTTATTTGAGAGACGTTGCTACTGCGGTTGCCTTGCTTCTTGACAATTTGTGCTGTGGGAGACCAAATCTCAACAATGACAACGAGGATACCATTCAGCAAACAGATTCAACTTCTCCTGTTGTTGATCCCTCTAGTTCATCCCAGTCAATGGATTCAACATCTGTAGTTGATGCCATATCGGACTCCACAAATCCCTCTGCTTCATTTCCCTCCGTGGAGTATGACGTGTTTTTGAGTTTCAGGGGTCCAGATACTCGTTATCAAATCACCGACATCCTCTATCGTTTTCTTTGTCGCTCAAAGATCCACACGTTTAAAGACGATGATGAGCTTCATAAGGGAGAAGAGATAAAGGTCAACCTCCTCAGAGCAATCGACCAGTCGAAAATTTATGTTCCCATCATATCGAGGGGTTATGCCGATAGTAAATGGTGTCTCATGGAGCTTGCAAAAATTGTTCGGCATCAAAAGCTGGACACTCGACAGATTATAATTCCTATTTTTTATATGGTGGATCCAAAAGATGTGAGACATCAGACTGGACCTTATCGAAAGGCATTTCAAAAACACTCAACTAGATATGATGAAATGACCATACGAAGCTGGAAGAATGCTCTAAATGAGGTTGGAGCTTTAAAAGGATGGCACGTGAAAAACAATGACGAGCAAGGAGCTATAGCAGATGAAGTTTCTGCAAATATATGGTCACATATAAGCAAGGAAAATTTCATTTTAGAAACTGATGAGTTGGTTGGAATTGATGATCACGTAGAAGTTATATTAGAAATGTTGAGTCTAGACTCTAAAAGTGTGACAATGGTCGGTCTTTATGGTATGGGCGGAATAGGCAAGACAACTACTGCAAAGGCGGTTTATAACAAGATTTCTTCTCATTTTGATCGATGTTGTTTCGTTGATAATGTACGAGCAATGCAAGAGCAGAAGGATGGCATTTTTATTTTGCAAAAGAAGCTGGTATCTGAAATTTTGAGGATGGATTCTGTTGGATTTACTAATGATAGTGGCGGAAGGAAGATGATAAAGGAGAGAGTTTCGAAGTCCAAAATTCTTGTCGTTCTCGATGATGTTGATGAGAAGTTTAAATTTGAAGATATACTCGGCTGTCCTAAAGATTTTGATTCTGGGACTAGATTCATCATTACTTCAAGAAATCAAAATGTCTTGAGTCGTTTGAATGAGAATCAATGCAAGTTGTATGAAGTTGGATCGATGAGCGAACAACATTCGCTCGAACTCTTCTCCAAACACGCATTCAAAAAGAATACGCCTCCATCGGATTATGAGACTCTAGCAAATGATATCGTATCGACTACAGGAGGACTTCCATTGACTTTGAAGGTTACAGGTTCATTTTTATTCAGACAAGAGATTGGGGTTTGGGAAGATACGTTGGAACAGTTACGTAAAACACTTGACCTTGATGAGGTTTATGATAGGCTAAAAATAAGTTACGATGCCTTGAAGGCGGAGGCAAAAGAGATTTTCTTGGATATAGCCTGCTTCTTCATCGGCCGAAATAAAGAAATGCCGTATTACATGTGGAGCGAGTGCAAATTTTATCCTAAAAGTAATATTATTTTTCTCATTCAAAGATGTATGATACAAGTTGGGGATGATGGGGTGTTAGAAATGCACGACCAACTTAGAGATATGGGTAGAGAAATTGTGAGACGAGAGGATGTGCAACGGCCGTGGAAGAGAAGTAGGATATGGTCGAGAGAAGAAGGAATTGATCTTTTGTTGAACAAAAAGGGATCAAGTCAAGTAAAAGCAATTAGCATACCCAACAATATGCTATATGCTTGGGAGTCGGGTGTCAAGTATGAGTTTAAAAGCGAATGTTTCTTGAATTTGTCAGAGTTGAGATTATTTTTTGTAGGATCAACCACATTGCTTACCGGAGATTTCAATAATCTTCTCCCGAATTTGAAGTGGCTTGACTTGCCACGTTACGCACATGGACTGTATGATCCTCCTGTGACCAATTTTACTATGAAAAAATTGGTAATTCTTGTTTCGACCAATAGCAAAACAGAGTGGAGCCATATGATTAAGATGGCTCCGAGGCTGAAAGTTGTACGACTTTATTCCGACTATGGGGTCTCCCAAAGACTTTCTTTCTGTTGGCGCTTCCCCAAAAGCATTGAGGTATTATCCATGTCTGGGATAGAAATCAAGGAAGTTGATATTGGGGAGTTAAAGAACCTAAAGACGTTGGATCTGACCTCATGTCGAATACAAAAGATAAGTGGGGGAACCTTTGGTATGTTGAAGGGACTCATAGAGCTTCGTCTCGACTCCATCAAGTGTACAAATTTGAGAGAAGTAGTTGCCGATATTGGACAACTTTCGTCTCTCAAAGTCTTGAAAACAGAAGGAGCTCAGGAGGTCCAGTTTGAATTTCCATTAGCTTTGAAGGAGTTATCCACTTCATCTCGGATACCGAATCTTTCACAGTTGTTGGATTTGGAGGTACTGAAGGTTTATGGTTGCAACGATGGATTCGACATCCCTCCTGCTAAGAGTACTGAAGATGAAGGTAGCGTGTGGTGGAAGGCATCCAAGTTGAAGTCTTTGAAACTCTATCGCACAAGAATCAATATAAACGTTGTGGATGCTTCTTCCGGTGGTCGTTATTTACTACCATCGTCGCTAACCTCTCTCGAAATTTATTGGTGTAAAGAACCAACGTGGCTTCCAGGAATAGAGAACTTGGAGAATTTGACTTCGCTGGTAGTCGACGATGTCGACATCTTCCAAACTCTTGGAGGTGATTTGGATGGGCTACAAGGGTTGAGATCGTTGGAAACTCTTACTATTACGGAAGTAAATGGTTTAACTCGGATCAAAGGGCTTATGGATCTCTTGTGTTCTTCTACCTGCAAGTTGGAGAAATTAGAGATTAAAGCATGCCATGACCTCACTGAGATACTCCCATGCGAACTCCACGACCAAACAGTAGTAGTCCCCTCTTTTGAAAAACTGACCATTAGGGATTGTCCACGGCTGGAGGTTGGTCCGATGATACGATCTCTCCCAAAGTTCCCAATGCTAAAGAAGTTGGACCTTGCGGTGGCAAATATAACTAAAGAGGAGGATCTGGATGTGATTGGATCCTTACAAGAGTTGGTTGATTTACGGATAGAGTTAGATGATACATCTTCCGGTATAGAGAGGATAGCTTCCTTGTCGAAGCTGAAAAAGTTAACTACACTCAGAGTGAAGGTGCCGAGTTTGCGGGAGATTGAAGAGCTTGCAGCGTTGAAGTCTTTACAAAGGTTGATTTTAGAGGGTTGCACGTCGTTGGAGAGACTACGTCTGGAGAAGCTGAAGGAGCCAGACATTGGAGGATGCCCTGACCTCACTGAGTTAGTCCAAACAGTAGTAGTATGCCCCTCTTTGGTAGAACTGACCATTAGGGATTGTCCACGGCTGGAGGTTGGTCCGATGATTCGATCTCTCCCAAAGTTCCCAATGCTAAAGAAGTTGGACCTCGCGGTGGCAAATATAATTGAGGAGGATCTGGATGTGATTGGATCCCTAGAAGAGTTGGTTATTTTGTCGTTAAAGTTAGATGATACATCTTCTTCCAGCATAGAGAGGATATCTTTCTTGTCAAAGCTGCAAAAGTTATTTAGACTCAGAGTGAAGGTGTCGAGTTTGCGGGAGATTGAAGGGCTTGCAGAGTTGAAGTCTTTACAACTTTTGTTTCTAAAGGGATGCACGTCGTTGGAGAGACTATGGCCTGATGAACAGCAACTCGATAATAATAAGAGTATGCGGATAGACATCCGAGGATGCAAAAGCTTGAGTGTAGATCATCTCTCTGCACTCAAGAGCACTCTACCGCCCAATGTAAAGATAAGATGGCCGGACGAGAAATATAAGTGA


Protein sequences

Name Description Sequence
rust resistance protein M rust resistance protein M [Linum usitatissimum].

MSYLRDVATAVALLLDNLCCGRPNLNNDNEDTIQQTDSTSPVVDPSSSSQSMDSTSVVDAISDSTNPSASFPSVEYDVFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNEVGALKGWHVKNNDEQGAIADEVSANIWSHISKENFILETDELVGIDDHVEVILEMLSLDSKSVTMVGLYGMGGIGKTTTAKAVYNKISSHFDRCCFVDNVRAMQEQKDGIFILQKKLVSEILRMDSVGFTNDSGGRKMIKERVSKSKILVVLDDVDEKFKFEDILGCPKDFDSGTRFIITSRNQNVLSRLNENQCKLYEVGSMSEQHSLELFSKHAFKKNTPPSDYETLANDIVSTTGGLPLTLKVTGSFLFRQEIGVWEDTLEQLRKTLDLDEVYDRLKISYDALKAEAKEIFLDIACFFIGRNKEMPYYMWSECKFYPKSNIIFLIQRCMIQVGDDGVLEMHDQLRDMGREIVRREDVQRPWKRSRIWSREEGIDLLLNKKGSSQVKAISIPNNMLYAWESGVKYEFKSECFLNLSELRLFFVGSTTLLTGDFNNLLPNLKWLDLPRYAHGLYDPPVTNFTMKKLVILVSTNSKTEWSHMIKMAPRLKVVRLYSDYGVSQRLSFCWRFPKSIEVLSMSGIEIKEVDIGELKNLKTLDLTSCRIQKISGGTFGMLKGLIELRLDSIKCTNLREVVADIGQLSSLKVLKTEGAQEVQFEFPLALKELSTSSRIPNLSQLLDLEVLKVYGCNDGFDIPPAKSTEDEGSVWWKASKLKSLKLYRTRININVVDASSGGRYLLPSSLTSLEIYWCKEPTWLPGIENLENLTSLVVDDVDIFQTLGGDLDGLQGLRSLETLTITEVNGLTRIKGLMDLLCSSTCKLEKLEIKACHDLTEILPCELHDQTVVVPSFEKLTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDVIGSLQELVDLRIELDDTSSGIERIASLSKLKKLTTLRVKVPSLREIEELAALKSLQRLILEGCTSLERLRLEKLKEPDIGGCPDLTELVQTVVVCPSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVILSLKLDDTSSSSIERISFLSKLQKLFRLRVKVSSLREIEGLAELKSLQLLFLKGCTSLERLWPDEQQLDNNKSMRIDIRGCKSLSVDHLSALKSTLPPNVKIRWPDEKYK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
64-217 TIR
Toll/interleukin-1 receptor homology (TIR) domain

STNPSASFPSVEYDVFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNEVGALKGW

ProfileScan: PS50104
IPR000157
74-214 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VEYDVFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNEVGAL

Gene3D: G3DSA:3.40.50.10140
74-210 G3DSA:3.40.50.10140

VEYDVFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNE

HMMSmart: SM00255
IPR000157
75-214 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EYDVFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNEVGAL

HMMPfam: PF01582
IPR000157
78-209 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALN

HMMPanther: PTHR11017:SF20
101-1279 PTHR11017:SF20,SUBFAMILY NOT NAMED

RSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNEVGALKGWHVKNNDEQGAIADEVSANIWSHISKENFILETDELVGIDDHVEVILEMLSLDSKSVTMVGLYGMGGIGKTTTAKAVYNKISSHFDRCCFVDNVRAMQEQKDGIFILQKKLVSEILRMDSVGFTNDSGGRKMIKERVSKSKILVVLDDVDEKFKFEDILGCPKDFDSGTRFIITSRNQNVLSRLNENQCKLYEVGSMSEQHSLELFSKHAFKKNTPPSDYETLANDIVSTTGGLPLTLKVTGSFLFRQEIGVWEDTLEQLRKTLDLDEVYDRLKISYDALKAEAKEIFLDIACFFIGRNKEMPYYMWSECKFYPKSNIIFLIQRCMIQVGDDGVLEMHDQLRDMGREIVRREDVQRPWKRSRIWSREEGIDLLLNKKGSSQVKAISIPNNMLYAWESGVKYEFKSECFLNLSELRLFFVGSTTLLTGDFNNLLPNLKWLDLPRYAHGLYDPPVTNFTMKKLVILVSTNSKTEWSHMIKMAPRLKVVRLYSDYGVSQRLSFCWRFPKSIEVLSMSGIEIKEVDIGELKNLKTLDLTSCRIQKISGGTFGMLKGLIELRLDSIKCTNLREVVADIGQLSSLKVLKTEGAQEVQFEFPLALKELSTSSRIPNLSQLLDLEVLKVYGCNDGFDIPPAKSTEDEGSVWWKASKLKSLKLYRTRININVVDASSGGRYLLPSSLTSLEIYWCKEPTWLPGIENLENLTSLVVDDVDIFQTLGGDLDGLQGLRSLETLTITEVNGLTRIKGLMDLLCSSTCKLEKLEIKACHDLTEILPCELHDQTVVVPSFEKLTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDVIGSLQELVDLRIELDDTSSGIERIASLSKLKKLTTLRVKVPSLREIEELAALKSLQRLILEGCTSLERLRLEKLKEPDIGGCPDLTELVQTVVVCPSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVILSLKLDDTSSSSIERISFLSKLQKLFRLRVKVSSLREIEGLAELKSLQLLFLKGCTSLERLWPDEQQLDNNKSMRIDIRGCKSL

HMMPanther: PTHR11017
101-1279 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVPIISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTRYDEMTIRSWKNALNEVGALKGWHVKNNDEQGAIADEVSANIWSHISKENFILETDELVGIDDHVEVILEMLSLDSKSVTMVGLYGMGGIGKTTTAKAVYNKISSHFDRCCFVDNVRAMQEQKDGIFILQKKLVSEILRMDSVGFTNDSGGRKMIKERVSKSKILVVLDDVDEKFKFEDILGCPKDFDSGTRFIITSRNQNVLSRLNENQCKLYEVGSMSEQHSLELFSKHAFKKNTPPSDYETLANDIVSTTGGLPLTLKVTGSFLFRQEIGVWEDTLEQLRKTLDLDEVYDRLKISYDALKAEAKEIFLDIACFFIGRNKEMPYYMWSECKFYPKSNIIFLIQRCMIQVGDDGVLEMHDQLRDMGREIVRREDVQRPWKRSRIWSREEGIDLLLNKKGSSQVKAISIPNNMLYAWESGVKYEFKSECFLNLSELRLFFVGSTTLLTGDFNNLLPNLKWLDLPRYAHGLYDPPVTNFTMKKLVILVSTNSKTEWSHMIKMAPRLKVVRLYSDYGVSQRLSFCWRFPKSIEVLSMSGIEIKEVDIGELKNLKTLDLTSCRIQKISGGTFGMLKGLIELRLDSIKCTNLREVVADIGQLSSLKVLKTEGAQEVQFEFPLALKELSTSSRIPNLSQLLDLEVLKVYGCNDGFDIPPAKSTEDEGSVWWKASKLKSLKLYRTRININVVDASSGGRYLLPSSLTSLEIYWCKEPTWLPGIENLENLTSLVVDDVDIFQTLGGDLDGLQGLRSLETLTITEVNGLTRIKGLMDLLCSSTCKLEKLEIKACHDLTEILPCELHDQTVVVPSFEKLTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDVIGSLQELVDLRIELDDTSSGIERIASLSKLKKLTTLRVKVPSLREIEELAALKSLQRLILEGCTSLERLRLEKLKEPDIGGCPDLTELVQTVVVCPSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVILSLKLDDTSSSSIERISFLSKLQKLFRLRVKVSSLREIEGLAELKSLQLLFLKGCTSLERLWPDEQQLDNNKSMRIDIRGCKSL

superfamily: SSF52540
235-480 SSF52540

NIWSHISKENFILETDELVGIDDHVEVILEMLSLDSKSVTMVGLYGMGGIGKTTTAKAVYNKISSHFDRCCFVDNVRAMQEQKDGIFILQKKLVSEILRMDSVGFTNDSGGRKMIKERVSKSKILVVLDDVDEKFKFEDILGCPKDFDSGTRFIITSRNQNVLSRLNENQCKLYEVGSMSEQHSLELFSKHAFKKNTPPSDYETLANDIVSTTGGLPLTLKVTGSFLFRQEIGVWEDTLEQLRKTL

Gene3D: G3DSA:3.40.50.300
250-391 G3DSA:3.40.50.300

DELVGIDDHVEVILEMLSLDSKSVTMVGLYGMGGIGKTTTAKAVYNKISSHFDRCCFVDNVRAMQEQKDGIFILQKKLVSEILRMDSVGFTNDSGGRKMIKERVSKSKILVVLDDVDEKFKFEDILGCPKDFDSGTRFIITS

HMMPfam: PF00931
IPR002182
256-533 NB-ARC,NBS
NB-ARC

DDHVEVILEMLSLDSKSVTMVGLYGMGGIGKTTTAKAVYNKISSHFDRCCFVDNVRAMQEQKDGIFILQKKLVSEILRMDSVGFTNDSGGRKMIKERVSKSKILVVLDDVDEKFKFEDILGCPKDFDSGTRFIITSRNQNVLSRLNENQCKLYEVGSMSEQHSLELFSKHAFKKNTPPSDYETLANDIVSTTGGLPLTLKVTGSFLFRQEIGVWEDTLEQLRKTLDLDEVYDRLKISYDALKAEAKEIFLDIACFFIGRNKEMPYYMWSECKFYPKSN

FPrintScan: PR00364
IPR000767
275-290 DISEASERSIST
Disease resistance protein

MVGLYGMGGIGKTTTA

FPrintScan: PR00364
IPR000767
352-366 DISEASERSIST
Disease resistance protein

RVSKSKILVVLDDVD

FPrintScan: PR00364
IPR000767
447-461 DISEASERSIST
Disease resistance protein

TGGLPLTLKVTGSFL

superfamily: SSF52058
536-1018 SSF52058,LRR

FLIQRCMIQVGDDGVLEMHDQLRDMGREIVRREDVQRPWKRSRIWSREEGIDLLLNKKGSSQVKAISIPNNMLYAWESGVKYEFKSECFLNLSELRLFFVGSTTLLTGDFNNLLPNLKWLDLPRYAHGLYDPPVTNFTMKKLVILVSTNSKTEWSHMIKMAPRLKVVRLYSDYGVSQRLSFCWRFPKSIEVLSMSGIEIKEVDIGELKNLKTLDLTSCRIQKISGGTFGMLKGLIELRLDSIKCTNLREVVADIGQLSSLKVLKTEGAQEVQFEFPLALKELSTSSRIPNLSQLLDLEVLKVYGCNDGFDIPPAKSTEDEGSVWWKASKLKSLKLYRTRININVVDASSGGRYLLPSSLTSLEIYWCKEPTWLPGIENLENLTSLVVDDVDIFQTLGGDLDGLQGLRSLETLTITEVNGLTRIKGLMDLLCSSTCKLEKLEIKACHDLTEILPCELHDQTVVVPSFEKLTIRDCPRLEVGPMI

Gene3D: G3DSA:3.80.10.10
626-869 G3DSA:3.80.10.10

NLSELRLFFVGSTTLLTGDFNNLLPNLKWLDLPRYAHGLYDPPVTNFTMKKLVILVSTNSKTEWSHMIKMAPRLKVVRLYSDYGVSQRLSFCWRFPKSIEVLSMSGIEIKEVDIGELKNLKTLDLTSCRIQKISGGTFGMLKGLIELRLDSIKCTNLREVVADIGQLSSLKVLKTEGAQEVQFEFPLALKELSTSSRIPNLSQLLDLEVLKVYGCNDGFDIPPAKSTEDEGSVWWKASKLKSLK

FPrintScan: PR00364
IPR000767
740-756 DISEASERSIST
Disease resistance protein

GELKNLKTLDLTSCRIQ

Gene3D: G3DSA:3.80.10.10
875-960 G3DSA:3.80.10.10

ININVVDASSGGRYLLPSSLTSLEIYWCKEPTWLPGIENLENLTSLVVDDVDIFQTLGGDLDGLQGLRSLETLTITEVNGLTRIKG

Gene3D: G3DSA:3.80.10.10
965-1145 G3DSA:3.80.10.10

LCSSTCKLEKLEIKACHDLTEILPCELHDQTVVVPSFEKLTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDVIGSLQELVDLRIELDDTSSGIERIASLSKLKKLTTLRVKVPSLREIEELAALKSLQRLILEGCTSLERLRLEKLKEPDIGGCPDLTELVQTVVVCPSLVE

superfamily: SSF52047
970-1297 SSF52047,LRR

CKLEKLEIKACHDLTEILPCELHDQTVVVPSFEKLTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDVIGSLQELVDLRIELDDTSSGIERIASLSKLKKLTTLRVKVPSLREIEELAALKSLQRLILEGCTSLERLRLEKLKEPDIGGCPDLTELVQTVVVCPSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVILSLKLDDTSSSSIERISFLSKLQKLFRLRVKVSSLREIEGLAELKSLQLLFLKGCTSLERLWPDEQQLDNNKSMRIDIRGCKSLSVDHLSALKSTLPPNVKI

Gene3D: G3DSA:3.80.10.10
1146-1288 G3DSA:3.80.10.10

LTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVILSLKLDDTSSSSIERISFLSKLQKLFRLRVKVSSLREIEGLAELKSLQLLFLKGCTSLERLWPDEQQLDNNKSMRIDIRGCKSLSVDHLSALK


Diseases

Disease Pathogen Avirulence gene
Flax rust

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox