PRGDB00000488 (Pi-ta)

From PRG Wiki
Jump to: navigation, search
Pi-ta
Gene Type Reference_R-Genes,_manually_curated
GenBank 28629808 (AY196754)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa

Comment?

Oryza sativa (japonica cultivar-group) pi-ta protein (Pi-ta) gene, complete cds.

DNA Sequence

ATGGCGCCGGCGGTCAGTGCATCGCAGGGTGTCATCATGCGGTCCCTGACGAGCAAGCTCGACTCGCTGCTGCTGCAGCCGCCGGAGCCGCCGCCGCCTGCGCAACCGTCGTCGCTGCGGAAGGGGGAGAGGAAGAAGATCCTCCTCCTCAGAGGCGATCTCCGACACCTGCTAGATGACTACTACCTCCTCGTGGAGCCGCCGTCAGACACCGCGCCACCGCCAGACTCGACGGCGGCGTGCTGGGCTAAGGAGGTTCGCGAGCTCTCCTACGACGTCGACGACTTCCTCGACGAGCTAACGACCCAGCTCCTCCACCACCGCGGCGGCGGCGATGGCAGTAGCACTGCTGGTGCCAAGAAGATGATCAGCAGCATGATCGCCCGGCTTCGAGGGGAGCTTAACCGGCGGCGGTGGATCGCCGACGAGGTCACCCTGTTCAGCGCCCGCGTGAAGGAGGCCATTCGCCGCCAGGAGAGCTACCATCTTGGCAGGCGCACCTCGAGCTCGAGGCCGAGAGAAGAAGTCGACGACGACGATCGCGAGGACTCCGCCGGCAACGAACGCCGCCGGTTTCTGTCGCTGACGTTCGGGATGGACGACGCTGCTGTGCACGGCCAGCTCGTTGGTAGGGATATTTCGATGCAAAAGCTCGTCCGGTGGCTGGCCGACGGCGAGCCGAAGCTCAAGGTGGCTTCCATTGTTGGATCCGGAGGTGTTGGCAAGACGACGCTGGCCACAGAATTCTATCGTCTGCATGGCCGGCGGTTGGATGCGCCGTTCGACTGCCGGGCTTTCGTGCGGACGCCCCGGAAGCCTGACATGACGAAGATCCTCACCGACATGCTGTCACAGCTGCGGCCACAACATCAGCATCAGTCTTCGGATGTTTGGGAGGTTGATCGACTCCTTGAAACTATCCGGACGCATTTGCAAGATAAAAGGTACTTCATCATAATTGAAGATTTATGGGCTTCATCAATGTGGGATATTGTTAGCCGTGGTTTGCCTGATAATAATAGTTGCAGTAGAATACTAATAACAACAGAAATTGAACCTGTAGCTTTGGCATGCTGTGGATATAACTCAGAGCACATTATTAAGATTGATCCACTGGGTGATGATGTCTCAAGTCAATTGTTTTTCAGTGGAGTTGTTGGCCAAGGAAATGAATTTCCTGGACATCTTACTGAAGTTTCTCATGACATGATAAAAAAATGTGGTGGCTTGCCACTAGCAATAACTATAACAGCCAGACATTTTAAAAGCCAGCTGTTAGATGGAATGCAGCAATGGAATCACATACAAAAATCATTGACTACTTCCAATTTGAAGAAAAATCCTACTTTGCAGGGGATGAGGCAAGTACTCAACCTTATTTACAATAATCTTCCTCATTGTTTGAAAGCATGTCTGTTATACCTTAGCATCTACAAAGAGGACTACATAATTAGGAAGGCCAACTTGGTGAGGCAATGGATGGCTGAAGGTTTCATCAATTCCATAGAAAATAAAGTCATGGAAGAAGTTGCAGGGAACTATTTTGATGAACTTGTTGGTAGGGGCCTGGTCCAACCAGTAGATGTTAACTGCAAAAATGAGGTATTGTCATGTGTAGTGCACCACATGGTATTAAATTTCATCAGGTGTAAGTCAATAGAGGAGAATTTCAGCATTACATTGGATCATTCTCAGACGACAGTAAGACATGCTGACAAGGTTCGCCGACTCTCGCTTCACTTCAGCAATGCACATGATACAACACCACTAGCAGGTTTGAGACTCTCACAAGTTCGATCGATGGCATTTTTCGGACAAGTCAAGTGTATGCCTTCCATTGCAGATTATAGGCTTCTTCGAGTTCTGATTCTTTGTTTTTGGGCTGATCAAGAGAAAACAAGCTATGACCTCACAAGCATTTTTGAACTGTTACAACTGAGATATCTGAAGATAACAGGTAATATCACAGTTAAACTTCCAGAGAAGATCCAAGGACTACAACACTTGCAGACACTGGAAGCAGATGCAAGAGCAACTGCTGTCCTATTGGATATTGTTCATACACAGTGTTTGTTGCACCTTCGTCTTGTACTACTTGATCTGCTCCCTCACTGTCACAGGTACATCTTCACCAGCATCCCCAAATGGACTGGAAAGCTCAACAATCTCCGCATTTTAAACATTGCAGTCATGCAAATTTCCCAGGATGACCTTGACACTCTCAAAGGACTGGGATCTCTCACTGCTCTTTCGCTGCTTGTTCGAACAGCGCCTGCGCAAAGAATCGTCGCTGCGAATGAGGGGTTCGGGTCTCTCAAGTACTTCATGTTTGTCTGTACAGCACCATGCATGACTTTTGTGGAAGGAGCAATGCCGAGTGTGCAAAGATTAAATCTAAGGTTCAATGCCAACGAGTTCAAGCAGTATGACTCTAAGGAGACAGGGTTGGAACACTTGGTCGCCCTTGCAGAGATCTCTGCAAGAATTGGGGGCACTGATGATGATGAATCAAACAAAACTGAAGTGGAGTCTGCCTTGAGGACTGCAATTCGCAAGCATCCGACGCCGAGCACTCTTATGGTTGATATACAATGGGTGGATTGGATCTTTGGTGCTGAAGGGAGAGACTTGGATGAAGATTTGGCACAACAAGATGATCACGGGTATGGATTTTTCATTCTATTCCCAGGTTACAACTTACAAGGATTATTGAGCTTCTTTCTTTCTCTGCCGTGGCTTCTATCTTTACCTTCTATGCATCTTCAACCTGACTTGATGATTGTTTGA


Protein sequences

Name Description Sequence
pi-ta protein pi-ta protein [Oryza sativa (japonica cultivar-group)].

MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGERKKILLLRGDLRHLLDDYYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQESYHLGRRTSSSRPREEVDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSIFELLQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKLNNLRILNIAVMQISQDDLDTLKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCTAPCMTFVEGAMPSVQRLNLRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKTEVESALRTAIRKHPTPSTLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGYGFFILFPGYNLQGLLSFFLSLPWLLSLPSMHLQPDLMIV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
57-624 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLDDYYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQESYHLGRRTSSSRPREEVDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLIL

HMMPanther: PTHR11017:SF126
57-624 PTHR11017:SF126,OS11G0237600 PROTEIN

LLDDYYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQESYHLGRRTSSSRPREEVDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLIL

superfamily: SSF52540
185-444 SSF52540

AGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNL

HMMPfam: PF00931
IPR002182
214-501 NB-ARC,NBS
NB-ARC

SMQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINS

Gene3D: G3DSA:3.40.50.300
215-320 G3DSA:3.40.50.300

MQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIII

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

VASIVGSGGVGKTTLA

FPrintScan: PR00364
IPR000767
310-324 DISEASERSIST
Disease resistance protein

HLQDKRYFIIIEDLW

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

CGGLPLAITITARHF

superfamily: SSF52058
539-752 SSF52058,LRR

VVHHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSIFELLQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKLNNLRILNIAVMQISQDDLDTLKGLGSLTALSL

Gene3D: G3DSA:3.80.10.10
633-752 G3DSA:3.80.10.10

TSYDLTSIFELLQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKLNNLRILNIAVMQISQDDLDTLKGLGSLTALSL


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea PRGAV00000051




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox