PRGDB00000490 (RFO1)

From PRG Wiki
Jump to: navigation, search
RFO1
Gene Type Reference_R-Genes,_manually_curated
GenBank 145337766 (NM_106616)
Gene Class RLK
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RFO1 (RESISTANCE TO FUSARIUM OXYSPORUM 1); kinase (RFO1) mRNA, complete cds.

DNA Sequence

ATGAAGAGAAGGAGACTTTTTTTCTCTGTTCTACTCTCTATCCTAACTCTGTTCATCAATGGTCCTTTGATAACGACAGCTCAATCTCCACCTTCTTCTTCAACTTCATGTAACCGTATCTGTGGAGGAATCGAGATTCCTTTTCCTTTTGGAATCGGACGAAGAGACTGTTTTCTCAACGACTGGTACGAGGTTGTCTGTAACAGCACCACCTCCGGTAAATCCTTAGCTCCGTTCCTCTATAAGATCAACAGAGAATTAGTTAGCATCACTCTTCGAAGCAGCATCGACAGTTCCTACGGAGTTGTTCACATTAAATCTCCGGTGACTTCCTCCGGCTGTTCTCAACGACCCGTAAAGCCTCTTCCTTTAAACCTCACCGGTAAAGGAAGTCCCTTTTTCATCACCGACTCGAATCGTCTCGTCTCAGTTGGTTGTGACAACAGAGCATTGATTACAGACATCGAATCTCAGATCACAGGATGCGAATCGAGCTGCGACGGAGATAAGAGTCGTTTAGACAAGATCTGCGGTGGTTACACATGTTGTCAGGCGAAGATTCCGGCGGATAGACCGCAAGTAATCGGCGTTGACCTTGAAAGCTCCGGTGGTAACACAACTCAAGGAGGAAACTGTAAAGTTGCTTTCTTGACGAATGAGACTTACTCTCCGGCGAATGTTACAGAGCCGGAACAATTTTATACTAATGGGTTTACGGTGATTGAGCTTGGTTGGTACTTTGATACATCAGATTCTCGGTTAACGAATCCTGTGGGTTGTGTGAATTTGACGGAAACAGGGATTTACACGAGCGCACCGAGCTGTGTTTGTGAGTATGGTAACTTCTCTGGCTTTGGTTACAGTAACTGTTACTGCAATCAGATTGGTTACAGAGGGAATCCTTATCTTCCTGGTGGATGCATTGACATTGACGAATGTGAGGAAGGAAAAGGACTAAGCAGCTGTGGAGAACTAACTTGTGTGAATGTTCCTGGATCGTGGAGGTGCGAGCTGAATGGAGTAGGGAAGATCAAGCCTCTGTTTCCAGGTCTTGTTCTAGGTTTTCCACTGTTGTTCTTGGTACTTGGGATATGGGGATTGATCAAGTTCGTTAAGAAGAGAAGGAAGATTATCCGAAAGAGAATGTTCTTTAAACGTAATGGAGGCTTGTTGTTGAAACAACAGTTAACTACAAGAGGAGGTAATGTGCAGTCATCGAAGATATTCAGTTCGAAAGAGCTGGAGAAAGCGACGGATAACTTCAATATGAACAGGGTTCTTGGGCAAGGAGGTCAAGGCACTGTCTACAAAGGAATGTTGGTAGATGGGCGAATTGTTGCTGTGAAAAGATCTAAAGTTTTAGATGAAGATAAAGTTGAGGAGTTTATCAATGAAGTTGGTGTTCTCTCGCAGATTAACCATAGAAATATTGTCAAACTCATGGGGTGTTGTCTCGAGACAGAGGTTCCTATCTTGGTTTATGAACATATTCCAAATGGAGACCTATTCAAGCGGCTTCACCATGATTCTGATGATTACACTATGACTTGGGATGTGCGATTGCGCATCTCTGTTGAGATTGCAGGAGCACTTGCTTACTTGCACTCGGCTGCATCAACTCCGGTCTATCATAGAGATGTCAAGACCACAAACATACTTTTGGATGAGAAGTATAGAGCCAAGGTATCGGATTTCGGGACCTCGAGATCCATAAACGTAGATCAAACTCACTTGACTACTCTAGTTGCAGGTACTTTTGGATACTTGGATCCAGAGTACTTTCAAACTAGCCAGTTTACGGATAAAAGTGATGTTTATAGTTTTGGGGTCGTCTTGGTTGAGCTCATAACTGGAGAAAAGCCGTTTTCTGTAATGCGGCCCGAAGAAAACAGAGGACTTGTGTCTCATTTCAATGAGGCTATGAAACAGAACAGAGTTCTTGATATTGTTGATTCTCGGATCAAAGAAGGTTGCACGTTGGAACAAGTGTTGGCTGTGGCGAAACTTGCCAGAAGGTGTTTAAGTCTAAAAGGGAAGAAACGACCAAATATGAGAGAGGTTTCAGTTGAGCTTGAGAGGATCCGTTCATCACCCGAAGATTTGGAGTTACATATTGAAGAGGAGGACGAAGAAGAATGCGCCATGGAAATCAACATGGATGATTCTTGGAGCGTCGACATGACTGCTCCAGCTTCCCTCTTTGATTTATCGCCCAAGTTAGACGTTGAACCGCTGGTTCCTCAACGAACATGGTGA


Protein sequences

Name Description Sequence
RFO1 (RESISTANCE TO FUSARIUM OXYSPORUM 1); kinase RFO1 (RESISTANCE TO FUSARIUM OXYSPORUM 1); kinase [Arabidopsis thaliana].

MKRRRLFFSVLLSILTLFINGPLITTAQSPPSSSTSCNRICGGIEIPFPFGIGRRDCFLNDWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVKPLPLNLTGKGSPFFITDSNRLVSVGCDNRALITDIESQITGCESSCDGDKSRLDKICGGYTCCQAKIPADRPQVIGVDLESSGGNTTQGGNCKVAFLTNETYSPANVTEPEQFYTNGFTVIELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVCEYGNFSGFGYSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCELNGVGKIKPLFPGLVLGFPLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPEDLELHIEEEDEEECAMEINMDDSWSVDMTAPASLFDLSPKLDVEPLVPQRTW

Domains

Domain Start-End Description Sequence

Seg: seg
29-36 seg

SPPSSSTS

HMMPfam: PF13947
IPR025287
35-147 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

TSCNRICGGIEIPFPFGIGRRDCFLNDWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVKPLPLNLTGKGSPFFITDSNRLVSVGCD

Seg: seg
40-53 seg

ICGGIEIPFPFGIG

HMMPfam: PF08488
IPR013695
174-279 WAK
Wall-associated kinase

DKICGGYTCCQAKIPADRPQVIGVDLESSGGNTTQGGNCKVAFLTNETYSPANVTEPEQFYTNGFTVIELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVCEY

HMMPanther: PTHR24420:SF444
278-722 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EYGNFSGFGYSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCELNGVGKIKPLFPGLVLGFPLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPEDLELHIEEEDEEECAMEINMDDS

HMMPanther: PTHR24420
278-722 FAMILY NOT NAMED,FAMILY NOT NAMED

EYGNFSGFGYSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCELNGVGKIKPLFPGLVLGFPLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPEDLELHIEEEDEEECAMEINMDDS

Gene3D: G3DSA:2.10.25.10
309-337 no description

DIDECEEGKGLSSCGELTCVNVPGSWRCE

Seg: seg
346-363 seg

PLFPGLVLGFPLLFLVLG

Seg: seg
368-386 seg

IKFVKKRRKIIRKRMFFKR

superfamily: SSF56112
IPR011009
393-705 Protein kinase-like (PK-like)
Protein kinase-like domain

KQQLTTRGGNVQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPEDLELHI

Gene3D: G3DSA:3.30.200.20
405-482 no description

SSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMG

HMMSmart: SM00219
IPR020635
421-691 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVEL

ProfileScan: PS50011
IPR000719
421-694 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERI

HMMSmart: SM00220
IPR002290
421-694 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERI

HMMPfam: PF00069
IPR000719
422-687 Pkinase,Ser-thr
Protein kinase, catalytic domain

NMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREV

Gene3D: G3DSA:1.10.510.10
483-687 no description

CCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREV

PatternScan: PS00108
IPR008271
542-554 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDVKTTNILL

Seg: seg
699-712 seg

EDLELHIEEEDEEE


Diseases

Disease Pathogen Avirulence gene
Fusarium Wilt Fusarium oxysporum




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox