PRGDB00000492 (RPP13)

From PRG Wiki
Jump to: navigation, search
RPP13
Gene Type Reference_R-Genes,_manually_curated
GenBank 30692728 (NM_114520)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPP13 (RECOGNITION OF PERONOSPORA PARASITICA 13); ATP binding (RPP13) mRNA, complete cds.

DNA Sequence

ATGGTAGATGCGATCACGGAGTTCGTTGTGGGAAAGATCGGCAACTATCTCATTGAAGAAGCATCAATGTTTATGGCAGTCAAAGAGGATCTAGAAGAGCTGAAGACGGAGTTGACGTGCATCCATGGTTATCTCAAGGACGTTGAAGCGCGAGAAAGAGAAGATGAGGTCTCAAAAGAGTGGTCAAAACTGGTTTTAGATTTCGCTTATGACGTCGAAGATGTTTTGGACACTTATCACTTGAAACTCGAAGAAAGGTCACAAAGGCGAGGCTTGAGGAGATTGACCAACAAAATAGGCAGGAAGATGGATGCGTACAGCATAGTTGATGATATCAGAATTCTCAAGAGAAGAATTTTGGATATCACTCGCAAGAGGGAGACTTATGGTATAGGAGGCTTGAAAGAGCCTCAAGGAGGAGGGAATACTTCAAGTTTGAGAGTGAGACAACTTCGGCGTGCTCGATCTGTTGATCAAGAAGAGGTTGTAGTTGGTTTGGAAGATGATGCTAAGATTCTTTTGGAAAAGCTTCTTGATTATGAAGAGAAAAATAGATTTATTATCTCGATCTTCGGTATGGGAGGCCTTGGAAAGACTGCACTTGCTAGGAAGCTCTACAACTCAAGGGATGTGAAGGAAAGATTCGAATACCGCGCATGGACTTATGTTTCTCAAGAGTATAAAACTGGAGATATACTAATGAGAATCATTAGATCTTTGGGAATGACTTCTGGGGAAGAGTTGGAAAAGATCAGAAAGTTTGCAGAGGAAGAGTTAGAAGTTTACCTTTACGGTCTTCTAGAAGGGAAAAAATATTTGGTGGTGGTGGATGATATATGGGAGCGAGAAGCGTGGGACAGCTTAAAGAGAGCGTTACCTTGCAACCATGAAGGAAGTAGAGTCATCATCACTACGCGTATTAAAGCCGTGGCTGAAGGCGTAGATGGGAGATTCTATGCTCATAAGTTAAGGTTCTTGACGTTTGAAGAAAGCTGGGAGTTGTTTGAACAAAGAGCATTCAGGAATATACAAAGGAAGGATGAAGATTTGCTGAAAACCGGAAAAGAAATGGTTCAAAAATGCAGAGGGTTACCACTTTGTATAGTTGTTCTTGCGGGGCTTTTGTCGAGGAAGACACCAAGCGAGTGGAATGATGTTTGTAACAGTTTATGGAGACGCCTAAAGGATGACTCCATTCATGTTGCCCCTATTGTGTTTGATCTAAGTTTCAAGGAGCTGCGGCATGAGTCCAAACTCTGTTTTCTGTACCTTAGTATCTTCCCAGAGGACTATGAGATTGACCTAGAGAAGTTGATACACTTACTTGTAGCAGAAGGTTTTATACAAGGGGATGAAGAGATGATGATGGAAGATGTGGCTCGGTACTACATCGAAGAGCTGATAGATAGAAGCTTACTTGAAGCAGTGAGAAGAGAAAGAGGAAAAGTGATGTCTTGTAGAATCCATGATCTTCTGAGAGACGTGGCTATCAAGAAATCTAAAGAGCTCAACTTTGTAAACGTGTATAACGATCATGTGGCCCAACATTCTTCTACTACTTGCAGAAGGGAAGTGGTTCACCATCAGTTCAAGAGATACTCATCTGAGAAACGCAAGAACAAACGGATGCGATCCTTCTTATACTTTGGAGAATTCGACCATTTGGTAGGGCTTGATTTTGAAACATTGAAGCTACTTCGAGTGCTTGATTTCGGAAGTCTTTGGCTTCCTTTTAAAATTAATGGGGATCTGATCCACTTGAGGTACCTTGGAATTGATGGTAATTCTATCAACGATTTTGATATAGCAGCTATTATATCCAAGTTACGGTTTCTACAAACACTATTTGTATCTGACAATTATTTCATCGAGGAAACAATCGATCTCCGTAAGCTCACATCATTAAGACATGTCATAGGAAATTTTTTTGGAGGATTGCTTATAGGCGACGTAGCGAACCTTCAGACCTTGACGTCTATCTCCTTTGACAGCTGGAACAAACTAAAACCTGAGTTGCTCATAAATCTTCGAGATTTGGGGATTTCTGAAATGTCTAGGTCAAAGGAGAGAAGAGTTCATGTGAGCTGGGCTTCCTTGACTAAACTGGAAAGTCTTCGTGTTCTGAAGCTGGCGACGCCCACTGAAGTCCATTTATCGTTGGAATCAGAAGAAGCAGTTAGGTCCATGGATGTGATATCACGCAGTCTTGAATCCGTGACACTGGTTGGAATAACTTTCGAGGAAGACCCAATGCCTTTTTTGCAGAAAATGCCGAGACTGGAAGATCTGATCTTGTTAAGTTGTAATTACTCGGGGAAGATGAGCGTCAGCGAACAAGGTTTTGGTAGGCTGAGGAAGCTTGACTTGTTAATGAGAAGTTTAGATGAGTTGCAGATAGAAGAAGAGGCCATGCCCAATTTGATCGAGCTGGAAATAAGTGTTTCGAAAAGAGAAACAAAGCTGATAATTCCAAACCGTTTGCGAGCGTTTGGTCAAATCTACTGCTGA


Protein sequences

Name Description Sequence
RPP13 (RECOGNITION OF PERONOSPORA PARASITICA 13); ATP binding RPP13 (RECOGNITION OF PERONOSPORA PARASITICA 13); ATP binding [Arabidopsis thaliana].

MVDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDDIRILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIHLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYSSEKRKNKRMRSFLYFGEFDHLVGLDFETLKLLRVLDFGSLWLPFKINGDLIHLRYLGIDGNSINDFDIAAIISKLRFLQTLFVSDNYFIEETIDLRKLTSLRHVIGNFFGGLLIGDVANLQTLTSISFDSWNKLKPELLINLRDLGISEMSRSKERRVHVSWASLTKLESLRVLKLATPTEVHLSLESEEAVRSMDVISRSLESVTLVGITFEEDPMPFLQKMPRLEDLILLSCNYSGKMSVSEQGFGRLRKLDLLMRSLDELQIEEEAMPNLIELEISVSKRETKLIIPNRLRAFGQIYC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
13-834 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDDIRILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIHLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYSSEKRKNKRMRSFLYFGEFDHLVGLDFETLKLLRVLDFGSLWLPFKINGDLIHLRYLGIDGNSINDFDIAAIISKLRFLQTLFVSDNYFIEETIDLRKLTSLRHVIGNFFGGLLIGDVANLQTLTSISFDSWNKLKPELLINLRDLGISEMSRSKERRVHVSWASLTKLESLRVLKLATPTEVHLSLESEEAVRSMDVISRSLESVTLVGITFEEDPMPFLQKMPRLEDLILLSCNYSGKMSVSEQGFGRLRKLDLLMRSLDELQIEEEAMPNLIELEISVSKRETKLIIPNRLRAFGQIY

HMMPanther: PTHR11017:SF14
13-834 PTHR11017:SF14

IGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDDIRILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIHLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYSSEKRKNKRMRSFLYFGEFDHLVGLDFETLKLLRVLDFGSLWLPFKINGDLIHLRYLGIDGNSINDFDIAAIISKLRFLQTLFVSDNYFIEETIDLRKLTSLRHVIGNFFGGLLIGDVANLQTLTSISFDSWNKLKPELLINLRDLGISEMSRSKERRVHVSWASLTKLESLRVLKLATPTEVHLSLESEEAVRSMDVISRSLESVTLVGITFEEDPMPFLQKMPRLEDLILLSCNYSGKMSVSEQGFGRLRKLDLLMRSLDELQIEEEAMPNLIELEISVSKRETKLIIPNRLRAFGQIY

superfamily: SSF52540
146-397 SSF52540

LRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDD

HMMPfam: PF00931
IPR002182
169-450 NB-ARC,NBS
NB-ARC

DAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIHLLVAEGFIQG

Gene3D: G3DSA:3.40.50.300
173-318 G3DSA:3.40.50.300

LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHEGSRVIITTRIKAVAEGVDGRF

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LLEGKKYLVVVDDIW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CRGLPLCIVVLAGLL

superfamily: SSF52058
471-813 SSF52058,LRR

SLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYSSEKRKNKRMRSFLYFGEFDHLVGLDFETLKLLRVLDFGSLWLPFKINGDLIHLRYLGIDGNSINDFDIAAIISKLRFLQTLFVSDNYFIEETIDLRKLTSLRHVIGNFFGGLLIGDVANLQTLTSISFDSWNKLKPELLINLRDLGISEMSRSKERRVHVSWASLTKLESLRVLKLATPTEVHLSLESEEAVRSMDVISRSLESVTLVGITFEEDPMPFLQKMPRLEDLILLSCNYSGKMSVSEQGFGRLRKLDLLMRSLDELQIEEEAMPNLIELEIS

Gene3D: G3DSA:3.80.10.10
541-679 G3DSA:3.80.10.10

KRMRSFLYFGEFDHLVGLDFETLKLLRVLDFGSLWLPFKINGDLIHLRYLGIDGNSINDFDIAAIISKLRFLQTLFVSDNYFIEETIDLRKLTSLRHVIGNFFGGLLIGDVANLQTLTSISFDSWNKLKPELLINLRDL

FPrintScan: PR00364
IPR000767
700-716 DISEASERSIST
Disease resistance protein

TKLESLRVLKLATPTEV

Gene3D: G3DSA:3.80.10.10
734-789 G3DSA:3.80.10.10

RSLESVTLVGITFEEDPMPFLQKMPRLEDLILLSCNYSGKMSVSEQGFGRLRKLDL


Diseases

Disease Pathogen Avirulence gene
Downy mildew




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox