PRGDB00000494 (RPP8)

From PRG Wiki
Jump to: navigation, search
RPP8
Gene Type Reference_R-Genes,_manually_curated
GenBank 145358807 (NM_123713)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPP8 (RECOGNITION OF PERONOSPORA PARASITICA 8) (RPP8) mRNA, complete cds.

DNA Sequence

ATGGCTGAAGCATTTGTGTCGTTTGGACTTGAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGGGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGTTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAATTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGTGGAAAAGGAAAAGGGGTCAAGAAGCATGTGAGACGACTTGCTTGCTTCTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAGAGGATCTCTGAAGTGATTGGGGAAATGCAGAGTTTTGGGATACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGTGCAGAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAAAGCGATCTTGTCGGGGTGGAGCAGAGTGTTAAAGAATTGGTTGGTCATTTGGTGGAGAATGATGTTCATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGTAAAACCACTCTGGCTAGACAAGTCTTTCATCATGACTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCCCAACAATTTACACAGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGGATATTTTACAGATGGACGAATATGCACTTCAGCGTAAACTCTTTCAATTGTTAGAGGCCGGTAGATATTTAGTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATGTAATAAAAGCAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTGCTTACTTCTCGAAATGAAGGTGTTGGGATACATGCTGATCCAACATGTTTAACTTTTAGAGCAAGCATCCTTAACCCTGAAGAAAGTTGGAAGCTCTGTGAGAGAATAGTATTCCCTAGGAGAGATGAAACTGAAGTAAGGCTTGATGAAGAAATGGAAGCCATGGGAAAGGAAATGGTCACACATTGTGGAGGACTACCATTAGCTGTTAAAGCGTTGGGAGGCTTGTTAGCTAATAAACATACTGTTCCTGAGTGGAAAAGAGTTTTTGACAATATTGGATCTCAAATAGTAGGAGGATCGTGGTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTCTGAGTTATGAAGATTTGCCAACGCATTTAAAGCATTGCTTCCTTAACCTAGCCCATTTCCCCGAAGATTCCGAGATATCTACGTATAGTTTGTTCTATTACTGGGCTGCAGAAGGGATTTACGATGGATCAACCATCGAAGATAGTGGAGAATACTACCTAGAAGAGCTAGTGAGGAGAAATTTGGTTATTGCAGACGACAACTATTTGAGTTGGCAATCTAAATATTGTCAAATGCATGACATGATGAGAGAAGTATGTTTATCTAAAGCCAAAGAAGAGAACTTCCTACAAATTATCATAGACCCTACTTGCACCTCTACCATCAATGCTCAATCTCCTAGTAGATCTCGCAGACTCAGCATACATAGTGGTAAAGCCTTTCATATATTGGGACACAAAAACAAGACAAAGGTGAGATCTCTTATAGTTCCGAGATTCGAGGAAGACTATTGGATACGATCAGCTTCAGTCTTCCACAACTTAACATTGCTCAGGGTGTTGGATCTTTCTTGGGTAAAGTTTGAAGGAGGGAAGTTACCTTGTAGCATTGGAGGGCTCATCCACTTGAGATACTTGAGTTTATACGAGGCTAAGGTATCTCATCTACCTTCTACTATGCGGAACCTAAAGCTTCTGCTCTATTTGAACTTACGTGTTGATACCGAGGAACCGATTCACGTGCCAAATGTTTTGAAAGAGATGATACAGTTGAGGTACCTTTCCCTACCTCTTAAAATGGATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTATGGTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACTAAGCTCCGGTATCTCGCTGTATCTTTGAGCGAAAGGTGCAATTTTGAAACTCTATCGTCATCTCTCCGCGAATTGCGAAACCTCGAGACGCTTAATTTCCTTTTTTCGCTCGAAACATATATGGTTGATTATATGGGAGAGTTTGTTCTGGATCATTTTATTCATCTAAAACAGTTGGGATTGGCAGTACGTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTGTACACTTATTTCTAATTTATTGCGGCATGGAAGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATTTGAAGTCGGTTCGTTTAGCACGTAAGGCATTCCTAGGGAGCAGAATGGTGTGCTCAAAAGGCGGATTTCCTCAATTATGTGTTATAGAAATATCTAAAGAATCAGAGTTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTTTGACTATAGATGATTGCAAAAAGTTGAAGGAACTTCCAGATGGACTCAAGTACATAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAACTGGTACCAGGTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTATCAACTGTGACCAGTAG


Protein sequences

Name Description Sequence
RPP8 (RECOGNITION OF PERONOSPORA PARASITICA 8) RPP8 (RECOGNITION OF PERONOSPORA PARASITICA 8) [Arabidopsis thaliana].

MAEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-907 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

HMMPanther: PTHR23155
2-907 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

Coil: coil
24-52 coiled-coil

LQGIDGQLDGLKRQLRSLQSLLKDADAKK

Seg: seg
34-46 seg

LKRQLRSLQSLLK

Seg: seg
80-98 seg

VLNKLSGKGKGVKKHVRRL

Seg: seg
144-155 seg

QERQRVQREIRQ

superfamily: SSF52540
148-396 P-loop containing nucleoside triphosphate hydrolases

RVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVG

HMMPfam: PF00931
IPR002182
169-455 NB-ARC,NBS
NB-ARC

EQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYD

Gene3D: G3DSA:3.40.50.300
170-294 no description

QSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGW

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLEAGRYLVVLDDVW

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAVKALGGLL

superfamily: SSF52058
491-876 L domain-like,LRR

QMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEG

Seg: seg
622-631 seg

NLKLLLYLNL

Seg: seg
709-729 seg

FETLSSSLRELRNLETLNFLF

Gene3D: G3DSA:3.80.10.10
774-876 no description

HLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEG

FPrintScan: PR00364
IPR000767
840-856 DISEASERSIST
Disease resistance protein

GSMPCLRTLTIDDCKKL


Diseases

Disease Pathogen Avirulence gene
Downy mildew
Downy mildew




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox