PRGDB00000497 (RPS5)

From PRG Wiki
Jump to: navigation, search
RPS5
Gene Type Reference_R-Genes,_manually_curated
GenBank 145335420 (NM_101094)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPS5 (RESISTANT TO P. SYRINGAE 5) (RPS5) mRNA, complete cds.

DNA Sequence

ATGGGAGGTTGTTTCTCTGTTTCATTGCCATGTGATCAAGTAGTGAGTCAGTTCTCTCAGTTGTTATGTGTCAGGGGAAGTTATATTCACAATCTCTCCAAGAATCTGGCTTCTCTGCAGAAGGCCATGCGAATGCTCAAGGCTCGGCAATATGATGTGATAAGAAGGTTGGAAACAGAAGAGTTTACAGGGCGTCAACAAAGGCTTTCCCAAGTTCAGGTATGGCTTACTAGTGTCCTAATCATTCAAAACCAGTTTAATGATCTGCTTCGTAGTAATGAAGTTGAGCTTCAAAGGTTGTGTCTTTGTGGTTTCTGCTCCAAAGATTTGAAATTGAGCTATCGTTATGGGAAAAGAGTTATCATGATGTTGAAGGAAGTTGAGAGTCTCAGTTCTCAAGGATTCTTTGATGTGGTTTCTGAGGCAACTCCGTTTGCTGATGTGGATGAGATCCCTTTTCAACCCACAATTGTTGGTCAGGAGATAATGCTTGAAAAGGCATGGAACCGTCTCATGGAAGATGGATCCGGGATTTTGGGTCTGTACGGTATGGGGGGAGTAGGCAAAACGACACTACTCACGAAGATCAACAATAAGTTTTCTAAAATAGATGACAGATTTGATGTTGTGATATGGGTTGTTGTGTCTAGAAGTTCAACAGTCCGTAAGATACAAAGAGACATAGCAGAAAAGGTAGGCCTTGGGGGAATGGAGTGGAGCGAGAAAAACGATAACCAGATAGCCGTTGACATCCACAATGTCCTTAGGAGACGAAAGTTTGTTTTATTGTTGGATGACATATGGGAGAAAGTGAATTTAAAAGCGGTTGGAGTCCCGTATCCAAGCAAAGATAACGGATGCAAGGTAGCATTCACTACTCGTTCTCGAGATGTGTGTGGGCGCATGGGGGTTGATGATCCGATGGAAGTTAGCTGTCTACAACCCGAAGAATCTTGGGATTTGTTTCAAATGAAGGTTGGGAAAAATACACTGGGAAGTCACCCAGACATTCCCGGACTTGCTAGAAAAGTCGCTAGGAAATGTCGTGGCCTACCATTAGCACTCAATGTTATCGGTGAAGCTATGGCATGCAAAAGAACAGTACATGAATGGTGTCATGCCATTGACGTTTTAACATCATCTGCCATAGATTTTTCAGGTATGGAAGATGAAATTCTCCATGTTTTGAAGTATAGCTATGATAATTTAAATGGGGAGCTGATGAAATCCTGCTTCCTCTATTGCTCTCTGTTTCCTGAAGACTATCTTATTGATAAAGAGGGGTTGGTAGACTACTGGATAAGTGAGGGATTCATAAATGAAAAAGAAGGCAGAGAGAGGAATATTAACCAAGGTTATGAGATAATTGGTACCCTTGTCCGTGCATGTTTGTTGTTGGAGGAAGAAAGGAACAAATCAAACGTGAAAATGCATGATGTGGTTCGTGAGATGGCTCTATGGATATCATCCGATCTTGGGAAGCAAAAGGAGAAATGTATTGTGCGAGCTGGTGTTGGGTTACGTGAAGTACCAAAAGTCAAGGATTGGAACACTGTGAGAAAGATTTCTTTGATGAATAATGAGATTGAAGAGATATTTGACAGTCACGAGTGTGCTGCACTTACAACTCTATTTCTCCAAAAGAACGACGTGGTAAAGATCTCGGCTGAATTCTTTCGATGTATGCCTCATCTGGTGGTTTTAGATCTATCAGAGAATCAGAGTCTTAATGAATTACCAGAAGAAATATCAGAGCTGGCCTCTTTGAGATATTTCAACTTGTCATATACATGTATACATCAACTACCCGTTGGTTTATGGACATTGAAAAAGCTAATACATCTGAATCTCGAACACATGAGCAGTCTTGGGAGTATATTAGGGATATCAAATTTGTGGAATTTGAGGACATTGGGACTACGAGATTCCAGACTGTTGCTAGATATGAGTTTAGTGAAGGAGCTGCAGCTCTTAGAACATCTAGAAGTTATAACCCTAGATATATCATCAAGTTTGGTTGCAGAGCCATTGTTATGCTCTCAAAGGTTGGTGGAATGTATAAAAGAGGTAGATTTTAAGTACCTTAAGGAAGAATCAGTGAGAGTATTGACTTTGCCAACCATGGGTAATCTCCGCAAGCTCGGGATAAAAAGATGTGGAATGAGGGAGATAAAGATAGAGAGGACAACTTCATCATCGTCTCGGAACAAAAGTCCCACAACTCCATGCTTCTCAAACCTCTCCAGAGTCTTTATAGCTAAATGCCATGGTCTTAAGGATTTGACGTGGCTTTTGTTTGCTCCTAATCTTACTTTTCTTGAAGTTGGGTTCTCAAAGGAAGTAGAGGATATAATTAGTGAAGAGAAAGCTGAGGAGCATTCAGCTACGATTGTTCCTTTTAGGAAATTGGAGACACTACACCTGTTTGAATTACGCGGGCTCAAGAGAATCTATGCAAAGGCTCTGCATTTTCCGTGTCTGAAAGTTATCCACGTAGAAAAATGTGAAAAGCTGAGAAAGCTTCCATTGGATTCTAAAAGTGGGATCGCGGGTGAAGAACTTGTCATATATTATGGAGAGAGAGAATGGATAGAAAGGGTTGAATGGGAGGACCAAGCAACTCAACTCCGTTTCTTACCTTCATCCAGGTGGCGGTGGAGAGAAACATAA


Protein sequences

Name Description Sequence
RPS5 (RESISTANT TO P. SYRINGAE 5) RPS5 (RESISTANT TO P. SYRINGAE 5) [Arabidopsis thaliana].

MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFNDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPSSRWRWRET

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
7-881 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFNDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPS

HMMPanther: PTHR23155:SF108
7-881 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFNDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPS

Coil: coil
29-50 coiled-coil

IHNLSKNLASLQKAMRMLKARQ

superfamily: SSF52540
140-384 P-loop containing nucleoside triphosphate hydrolases

SEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAID

HMMPfam: PF00931
IPR002182
161-442 NB-ARC,NBS
NB-ARC

EIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEK

Gene3D: G3DSA:3.40.50.300
168-268 no description

WNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIW

Seg: seg
175-188 seg

GSGILGLYGMGGVG

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

ILGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
254-268 DISEASERSIST
Disease resistance protein

VLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGEAM

superfamily: SSF52058
460-880 L domain-like,LRR

VRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLP

Gene3D: G3DSA:3.80.10.10
503-837 no description

AGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEK

HMMPfam: PF13855
541-597 LRR_8,Leucine rich repeat

LTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYT

FPrintScan: PR00364
IPR000767
560-576 DISEASERSIST
Disease resistance protein

RCMPHLVVLDLSENQSL

Seg: seg
621-630 seg

SSLGSILGIS

Seg: seg
635-651 seg

LRTLGLRDSRLLLDMSL


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Pseudomonas syringae PRGAV00000047




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox