PRGDB00000500 (Rps1-k-2)

From PRG Wiki
Jump to: navigation, search
Rps1-k-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 183396496 (EU450800)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Glycine max

Comment?

Glycine max NB-LRR type disease resistance protein Rps1-k-1 (Rps1-k-1) and NB-LRR type disease resistance protein Rps1-k-2 (Rps1-k-2) genes, complete cds.

DNA Sequence

ATGGCAGCAGCACTGGTCGGTGGTGCCTTCCTCTCTGCTTTTCTTGATGTGGTTTTCGACAGGCTGGCTTCACCTGAGTTTGTTGACTTGATCCGTGGAAAGAAGCTTAGCAAGAAGTTGCTTCAAAAGTTGGAGACCACTCTCAGAGTGGTTGGAGCTGTGCTTGATGATGCCGAGAAGAAACAGATCACAAACACCAATGTCAAACACTGGCTCAATGATCTCAAACATGCTGTCTATGAAGCCGATGACTTACTCGACCATGTTTTCACCAAAGCTGCCACCCAAAACAAGGTAAGAGACTTGTTTTCTCGCTTTTCCGATAGGAAGATCGTTAGTAAGTTGGAGGACATAGTTGTCACACTTGAGTCTCATTTAAAACTCAAGGAGAGTCTTGATTTGAAAGAGAGTGCAGTGGAGAACTTGTCATGGAAAGCTCCATCAACATCTCTGGAAGATGGATCTCATATATATGGTAGGGAGAAAGATAAGGAGGCCATAATCAAGTTGTTGTCGGAGGATAACAGTGACGGTAGAGAAGTGTCTGTGGTTCCTATTGTGGGCATGGGTGGGGTTGGAAAAACTACTTTGGCCCAATTGGTGTACAACGATGAGAATTTGAAACAGATATTTGATTTTGATTTTAAGGCATGGGTTTGTGTTTCTCAAGAATTTGATGTTCTCAAGGTCACAAAAACTATAATAGAGGCGGTGACTGGAAAGGCTTGTAAATTGAATGATCTGAATCTACTTCATCTTGAATTGATGGACAAGCTGAAAGATAAAAAATTCTTAATTGTTTTGGATGATGTTTGGACAGAGGATTATGTTGATTGGCGTCTTCTTAAGAAACCATTTAACCGTGGGATTATTAGGAGAAGTAAAATTCTTCTAACAACCCGCAGTGAAAAAACAGCATCTGTAGTCCAAACTGTTCACACCTATCATCTAAACCAATTGTCGAATGAAGATTGTTGGTCAGTGTTTGCGAACCATGCATGTCTTTCCACGGAATCTAACGAGAACACAGCAACACTAGAAAAAATTGGAAAGGAGATTGTTAAAAAGTGCAACGGACTGCCTTTAGCAGCAGAGTCGCTTGGAGGCATGTTGAGAAGAAAGCATGACATTGGTGATTGGAATAATATTCTCAATAGTGACATTTGGGAACTTTCTGAAAGTGAGTGTAAAGTTATTCCAGCACTGAGACTTAGTTATCATTATCTCCCTCCACATTTAAAACGATGCTTTGTTTATTGTTCGTTGTATCCACAAGATTACGAATTTGAAAAAAATGAATTAATCTTGTTGTGGATGGCTGAAGATCTTTTGAAGAAACCAAGGAAAGGTAGGACTTTAGAAGAGGTTGGTCATGAGTATTTTGATGATTTGGTTTCGAGATCGTTTTTCCAACGTTCAAGAACAAGTAGTTGGCCTCATCGCAAATGTTTTGTGATGCATGACCTCATGCATGATCTAGCCACATCACTCGGTGGAGATTTTTATTTTAGATCAGAAGAACTTGGGAAAGAAACAAAGATCAATACCAAGACTCGTCATTTGTCATTTGCCAAATTCAATTCTTCAGTCTTGGACAACTTTGATGTTATTGGTAGAGCAAAATTTCTGAGAACCTTCTTGTCCATTATCAATTTTGAAGCTGCTCCATTCAACAATGAGGAGGCACAATGTATCATAATGTCGAAGCTTATGTACTTGAGAGTTTTATCATTTTGTGACTTCCAAAGTCTGGATTCTTTGCCTGATTCAATAGGTAAATTGATCCATCTGCGCTATTTAGATCTCTCTTTTTCAAGAATAGAAACACTGCCAAAGTCATTGTGTAATTTGTACAATCTGCAAACTTTGAAGTTGTGTAGTTGCAGAAAGCTGACTAAGTTGCCCAGTGACATGCGCAATCTTGTTAACTTGCGTCATCTTGGTATTGCTTATACTCCTATAAAAGAGATGCCGAGAGGAATGGGTAAATTAAATCATTTACAACATCTGGATTTCTTTGTTGTGGGCAAGCACGAAGAGAATGGAATCAAAGAATTGGGAGGACTTTCAAATCTTCGTGGTCAGCTTGAAATTAGGAAGTTGGAGAATGTTTCCCAAAGTGATGAAGCGTTGGAGGCAAGGATGATGGATAAAAAACACATTAATAGTTTACAGTTGGAATGGTCTGGATGTAACAACAACAGTACCAACTTCCAACTTGAAATAGATGTGCTTTGCAAGTTACAGCCTCACTTTAACATTGAATCGTTGGAAATAAAAGGTTATGAAGGAACCAGATTTCCAGATTGGATGGGAAATTCTTCCTACTGCAATATGATTAGTCTAAAATTGCGTGATTGTCACAACTGTAGTATGCTTCCTTCACTTGGACAACTACCTTCTCTCAAGGACCTTGGAATTGCACGATTGAATAGGCTGAAGACTATTGATGCAGGTTTCTACAAGAATGAAGAATGTCGTTCTGGGACGTCCTTTCCCTCCCTTGAATCTCTGTCCATTGATGACATGCCTTGTTGGGAGGTGTGGAGTTCCTTCGATTCAGAAGCTTTTCCTGTGCTTAACAGTCTTGAAATACGTGACTGCCCCAAACTAGAGGGAAGTTTGCCGAATCACCTTCCTGCTCTGACAAAACTTGTGATTAGAAATTGCGAGCTGCTTGTCTCTTCTCTCCCAACGGCTCCCGCCATTCAAAGTTTGGAGATATGTAAAAGCAATAAAGTAGCACTGCATGCGTTTCCTCTCTTGGTAGAAACTATAGAAGTAGAAGGAAGCCCAATGGTGGAGTCCGTGATCGAGGCCATCACTAACATCCAACCAACTTGTCTCCGGTCTTTAACATTAAGGGATTGTTCGTCAGCCGTGTCATTTCCGGGTGGTCGTTTACCTGAATCACTGAAGAGTCTGAGTATCAAGGATCTTAAAAAACTGGAATTCCCGACGCAACACAAACATGAGTTACTGGAAACACTGTCAATAGAAAGCAGTTGTGATTCACTCACATCTCTTCCATTGGTTACCTTTCCAAATCTCAGATATCTCAGCATCGAAAAGTGTGAAAATATGGAATATCTTTTGGTTTCAGGGGCAGAGTCATTTAAGAGTCTGTGTTATTTGTTAATTTACAAATGCCCCAACTTTGTATCATTCTGGAGAGAAGGATTGCCTGCGCCCAACTTGATTACTTTCAGTGTTTGGGGCTCTGACAAGTTGAAGTCGTTGCCTGATGAGATGAGTACTCTTCTCCCAAAGTTAGAAGATCTCACCATATCCAACTGCCCAGAAATTGAGTCCTTTCCAAAACGGGGTATGCCACCTAACCTGAGAAGAGTTGAGATTGTCAATTGTGAGAAACTACTGAGCGGCCTAGCATGGCCATCCATGGGCATGCTTACTCATCTCAATGTTGGGGGTCCATGTGATGGCATCAAGTCCTTCCCTAAAGAGGGTTTGCTGCCTCCCTCCCTTACGTCTCTGTCTCTATATGACTTGTCAAATCTGGAGATGTTGGACTGCACGGGGCTTCTCCATCTCACATCCCTGCAACAATTACAAATTTTTGGATGTCCAAAGCTGGAGAATATGGCTGGAGAAAGTCTTCCTTTCTCTCTAATAAAATTAACCATGGTGGAATGTCCTTTGCTGGAAAAACGATGCCGCATGAAGCACCCTCAAATTTGGCCTAAAGTTTCCCACATCCCTGGCATTAAGGTTGGCAATAGATGGATTTAG


Protein sequences

Name Description Sequence
NB-LRR type disease resistance protein Rps1-k-2 NB-LRR type disease resistance protein Rps1-k-2 [Glycine max].

MAAALVGGAFLSAFLDVVFDRLASPEFVDLIRGKKLSKKLLQKLETTLRVVGAVLDDAEKKQITNTNVKHWLNDLKHAVYEADDLLDHVFTKAATQNKVRDLFSRFSDRKIVSKLEDIVVTLESHLKLKESLDLKESAVENLSWKAPSTSLEDGSHIYGREKDKEAIIKLLSEDNSDGREVSVVPIVGMGGVGKTTLAQLVYNDENLKQIFDFDFKAWVCVSQEFDVLKVTKTIIEAVTGKACKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWRLLKKPFNRGIIRRSKILLTTRSEKTASVVQTVHTYHLNQLSNEDCWSVFANHACLSTESNENTATLEKIGKEIVKKCNGLPLAAESLGGMLRRKHDIGDWNNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFEKNELILLWMAEDLLKKPRKGRTLEEVGHEYFDDLVSRSFFQRSRTSSWPHRKCFVMHDLMHDLATSLGGDFYFRSEELGKETKINTKTRHLSFAKFNSSVLDNFDVIGRAKFLRTFLSIINFEAAPFNNEEAQCIIMSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSFSRIETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMRNLVNLRHLGIAYTPIKEMPRGMGKLNHLQHLDFFVVGKHEENGIKELGGLSNLRGQLEIRKLENVSQSDEALEARMMDKKHINSLQLEWSGCNNNSTNFQLEIDVLCKLQPHFNIESLEIKGYEGTRFPDWMGNSSYCNMISLKLRDCHNCSMLPSLGQLPSLKDLGIARLNRLKTIDAGFYKNEECRSGTSFPSLESLSIDDMPCWEVWSSFDSEAFPVLNSLEIRDCPKLEGSLPNHLPALTKLVIRNCELLVSSLPTAPAIQSLEICKSNKVALHAFPLLVETIEVEGSPMVESVIEAITNIQPTCLRSLTLRDCSSAVSFPGGRLPESLKSLSIKDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRYLSIEKCENMEYLLVSGAESFKSLCYLLIYKCPNFVSFWREGLPAPNLITFSVWGSDKLKSLPDEMSTLLPKLEDLTISNCPEIESFPKRGMPPNLRRVEIVNCEKLLSGLAWPSMGMLTHLNVGGPCDGIKSFPKEGLLPPSLTSLSLYDLSNLEMLDCTGLLHLTSLQQLQIFGCPKLENMAGESLPFSLIKLTMVECPLLEKRCRMKHPQIWPKVSHIPGIKVGNRWI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-894 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AFLSAFLDVVFDRLASPEFVDLIRGKKLSKKLLQKLETTLRVVGAVLDDAEKKQITNTNVKHWLNDLKHAVYEADDLLDHVFTKAATQNKVRDLFSRFSDRKIVSKLEDIVVTLESHLKLKESLDLKESAVENLSWKAPSTSLEDGSHIYGREKDKEAIIKLLSEDNSDGREVSVVPIVGMGGVGKTTLAQLVYNDENLKQIFDFDFKAWVCVSQEFDVLKVTKTIIEAVTGKACKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWRLLKKPFNRGIIRRSKILLTTRSEKTASVVQTVHTYHLNQLSNEDCWSVFANHACLSTESNENTATLEKIGKEIVKKCNGLPLAAESLGGMLRRKHDIGDWNNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFEKNELILLWMAEDLLKKPRKGRTLEEVGHEYFDDLVSRSFFQRSRTSSWPHRKCFVMHDLMHDLATSLGGDFYFRSEELGKETKINTKTRHLSFAKFNSSVLDNFDVIGRAKFLRTFLSIINFEAAPFNNEEAQCIIMSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSFSRIETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMRNLVNLRHLGIAYTPIKEMPRGMGKLNHLQHLDFFVVGKHEENGIKELGGLSNLRGQLEIRKLENVSQSDEALEARMMDKKHINSLQLEWSGCNNNSTNFQLEIDVLCKLQPHFNIESLEIKGYEGTRFPDWMGNSSYCNMISLKLRDCHNCSMLPSLGQLPSLKDLGIARLNRLKTIDAGFYKNEECRSGTSFPSLESLSIDDMPCWEVWSSFDSEAFPVLNSLEIRDCPKLEGSLPNHLPALTKLVIRNCELLV

HMMPanther: PTHR23155:SF236
9-894 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

AFLSAFLDVVFDRLASPEFVDLIRGKKLSKKLLQKLETTLRVVGAVLDDAEKKQITNTNVKHWLNDLKHAVYEADDLLDHVFTKAATQNKVRDLFSRFSDRKIVSKLEDIVVTLESHLKLKESLDLKESAVENLSWKAPSTSLEDGSHIYGREKDKEAIIKLLSEDNSDGREVSVVPIVGMGGVGKTTLAQLVYNDENLKQIFDFDFKAWVCVSQEFDVLKVTKTIIEAVTGKACKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWRLLKKPFNRGIIRRSKILLTTRSEKTASVVQTVHTYHLNQLSNEDCWSVFANHACLSTESNENTATLEKIGKEIVKKCNGLPLAAESLGGMLRRKHDIGDWNNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFEKNELILLWMAEDLLKKPRKGRTLEEVGHEYFDDLVSRSFFQRSRTSSWPHRKCFVMHDLMHDLATSLGGDFYFRSEELGKETKINTKTRHLSFAKFNSSVLDNFDVIGRAKFLRTFLSIINFEAAPFNNEEAQCIIMSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSFSRIETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMRNLVNLRHLGIAYTPIKEMPRGMGKLNHLQHLDFFVVGKHEENGIKELGGLSNLRGQLEIRKLENVSQSDEALEARMMDKKHINSLQLEWSGCNNNSTNFQLEIDVLCKLQPHFNIESLEIKGYEGTRFPDWMGNSSYCNMISLKLRDCHNCSMLPSLGQLPSLKDLGIARLNRLKTIDAGFYKNEECRSGTSFPSLESLSIDDMPCWEVWSSFDSEAFPVLNSLEIRDCPKLEGSLPNHLPALTKLVIRNCELLV

superfamily: SSF52540
137-393 SSF52540

SAVENLSWKAPSTSLEDGSHIYGREKDKEAIIKLLSEDNSDGREVSVVPIVGMGGVGKTTLAQLVYNDENLKQIFDFDFKAWVCVSQEFDVLKVTKTIIEAVTGKACKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWRLLKKPFNRGIIRRSKILLTTRSEKTASVVQTVHTYHLNQLSNEDCWSVFANHACLSTESNENTATLEKIGKEIVKKCNGLPLAAESLGGMLRRKHDIGDWNNILNSDIWELSE

Gene3D: G3DSA:3.40.50.300
159-306 G3DSA:3.40.50.300

GREKDKEAIIKLLSEDNSDGREVSVVPIVGMGGVGKTTLAQLVYNDENLKQIFDFDFKAWVCVSQEFDVLKVTKTIIEAVTGKACKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWRLLKKPFNRGIIRRSKILLTTRSEKTA

HMMPfam: PF00931
IPR002182
160-445 NB-ARC,NBS
NB-ARC

REKDKEAIIKLLSEDNSDGREVSVVPIVGMGGVGKTTLAQLVYNDENLKQIFDFDFKAWVCVSQEFDVLKVTKTIIEAVTGKACKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWRLLKKPFNRGIIRRSKILLTTRSEKTASVVQTVHTYHLNQLSNEDCWSVFANHACLSTESNENTATLEKIGKEIVKKCNGLPLAAESLGGMLRRKHDIGDWNNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFEKNELILLWMAEDLLK

FPrintScan: PR00364
IPR000767
183-198 DISEASERSIST
Disease resistance protein

VVPIVGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
258-272 DISEASERSIST
Disease resistance protein

KLKDKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CNGLPLAAESLGGML

superfamily: SSF52058
485-908 SSF52058,LRR

VMHDLMHDLATSLGGDFYFRSEELGKETKINTKTRHLSFAKFNSSVLDNFDVIGRAKFLRTFLSIINFEAAPFNNEEAQCIIMSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSFSRIETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMRNLVNLRHLGIAYTPIKEMPRGMGKLNHLQHLDFFVVGKHEENGIKELGGLSNLRGQLEIRKLENVSQSDEALEARMMDKKHINSLQLEWSGCNNNSTNFQLEIDVLCKLQPHFNIESLEIKGYEGTRFPDWMGNSSYCNMISLKLRDCHNCSMLPSLGQLPSLKDLGIARLNRLKTIDAGFYKNEECRSGTSFPSLESLSIDDMPCWEVWSSFDSEAFPVLNSLEIRDCPKLEGSLPNHLPALTKLVIRNCELLVSSLPTAPAIQSLEI

Gene3D: G3DSA:3.80.10.10
576-693 G3DSA:3.80.10.10

LSFCDFQSLDSLPDSIGKLIHLRYLDLSFSRIETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMRNLVNLRHLGIAYTPIKEMPRGMGKLNHLQHLDFFVVGKHEENGIKELGGLSNLR

HMMPfam: PF13504
596-611 LRR_7,Leucine rich repeat

HLRYLDLSFSRIETLP

FPrintScan: PR00364
IPR000767
615-631 DISEASERSIST
Disease resistance protein

CNLYNLQTLKLCSCRKL

Gene3D: G3DSA:3.80.10.10
753-890 G3DSA:3.80.10.10

NIESLEIKGYEGTRFPDWMGNSSYCNMISLKLRDCHNCSMLPSLGQLPSLKDLGIARLNRLKTIDAGFYKNEECRSGTSFPSLESLSIDDMPCWEVWSSFDSEAFPVLNSLEIRDCPKLEGSLPNHLPALTKLVIRNC

Gene3D: G3DSA:3.80.10.10
931-958 G3DSA:3.80.10.10

SPMVESVIEAITNIQPTCLRSLTLRDCS

superfamily: SSF52058
938-1238 SSF52058,LRR

IEAITNIQPTCLRSLTLRDCSSAVSFPGGRLPESLKSLSIKDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRYLSIEKCENMEYLLVSGAESFKSLCYLLIYKCPNFVSFWREGLPAPNLITFSVWGSDKLKSLPDEMSTLLPKLEDLTISNCPEIESFPKRGMPPNLRRVEIVNCEKLLSGLAWPSMGMLTHLNVGGPCDGIKSFPKEGLLPPSLTSLSLYDLSNLEMLDCTGLLHLTSLQQLQIFGCPKLENMAGESLPFSLIKLTMVECPLLEKRCRMKHPQIWPKVSH

Gene3D: G3DSA:3.80.10.10
1004-1052 G3DSA:3.80.10.10

DSLTSLPLVTFPNLRYLSIEKCENMEYLLVSGAESFKSLCYLLIYKCPN

Gene3D: G3DSA:3.80.10.10
1064-1211 G3DSA:3.80.10.10

PNLITFSVWGSDKLKSLPDEMSTLLPKLEDLTISNCPEIESFPKRGMPPNLRRVEIVNCEKLLSGLAWPSMGMLTHLNVGGPCDGIKSFPKEGLLPPSLTSLSLYDLSNLEMLDCTGLLHLTSLQQLQIFGCPKLENMAGESLPFSLI


Diseases

Disease Pathogen Avirulence gene
Phytophthora root Phytophthora sojae

List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox