PRGDB00000501 (Rps1-k-1)

From PRG Wiki
Jump to: navigation, search
Rps1-k-1
Gene Type Reference_R-Genes,_manually_curated
GenBank 183396496 (EU450800)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Glycine max

Comment?

Glycine max NB-LRR type disease resistance protein Rps1-k-1 (Rps1-k-1) and NB-LRR type disease resistance protein Rps1-k-2 (Rps1-k-2) genes, complete cds.

DNA Sequence

ATGGCTGCAGCACTGGTCGGTGGTGCCTTTCTCTCTGCTTTCCTTGATGTGCTTTTCGACAGGCTGGCTTCACCTGACTTTGTTGACTTGATCCTTGGAAAGAAGCTTAGCAAGAAGTTGCTTCGAAAGTTGGAGACCACTCTCAGAGTGGTTGGAGCTGTGCTTGATGATGCCGAGAAGAAACAGATCACAAACACCAATGTCAAACACTGGCTCAATGCTCTCAAAGATGCTGTCTATGAAGCCGATGACTTACTCGACCATGTTTTCACCAAAGCTGCCACCCAAAACAAGGTAAGAAACTTGTTTTCTCGCTTTTCCGATCGGAAGATCGTTAGTAAGTTGGAGGACATAGTTGTCACCCTAGAGTCTCATTTAAAACTCAAGGAGAGTCTTGATTTGAAAGAGAGTGCAGTGGAGAACTTGTCATGGAAAGCTCCATCAACATCTCTGGAAGATGGATCTCATATATATGGTAGGGAGAAAGATAGGGAGGCCATAATCAAGTTGTTGTCGGAGGATAACAGTGACGGTAGTGAAGTGTCTGTGGTTCCTATTGTGGGCATGGGTGGGGTTGGAAAAACTACTTTGGCCCAATTGGTGTACAATGATGAGAATTTGAAAGAGAAATTTGATTTTGATTTTAAGGCATGGGTTTGTGTTTCTCAAGAATTTGATGTTCTGAAGGTCACAAAAACTATAATACAGGCGGTTACTGGAAATCCTTGTAAATTGAATGATCTGAATCTACTTCATCTTGAATTGATGGACAAGCTGAAAGATAAAAAATTCCTAATTGTTTTGGATGATGTTTGGACAGAGGATTATGTTGATTGGAGTCTTCTTAAGAAACCATTTCAATGTGGGATTATTAGGAGAAGTAAAATTCTTCTAACAACCCGCAGTGAAAAGACAGCCTCCGTAGTCCAAACGGTTCAAACCTATCATCTAAACCAATTGTCGAATGAAGATTGTTGGTCAGTGTTTGCGAACCATGCGTGTCTTTCCTTGGAATCGAACGAGAACACAACACTAGAAAAAATTGGAAAGGAGATTGTTAAAAAGTGCGATGGACTGCCTTTAGCAGCACAGTCCCTTGGAGGCATGTTGAGAAGAAAGCATGACATTGGGGATTGGTATAATATTCTGAATAGTGACATTTGGGAACTTTCTGAAAGTGAGTGTAAAGTTATTCCAGCACTGAGACTTAGTTATCATTATCTCCCTCCACATTTAAAACGGTGCTTTGTTTATTGTTCGTTGTATCCCCAAGATTACGAATTTGATAAAAATGAATTAATCTTGTTGTGGATGGCTGAAGATCTTTTGAAGAAACCAAGGAAAGGTAGGACTTTAGAAGAGGTTGGTCATGAGTATTTTGATGATTTGGTTTCGAGATCATTTTTCCAACGTTCAAGTACAAATAGAAGTAGTTGGCCTTATGGTGAATGTTTTGTGATGCATGACCTCATGCATGATCTAGCCAAATCACTCGGTGGAGATTTTTATTTTAGATCAGAAGAACTTGGGAAAGAAACAAAGATCAATACTAAGACTCGTCATTTGTCATTTACCAAATTCAATTCTTCAGTCTTGGACAACTTTGATGTTGTTGGTAGAGCAAAATTTCTGAGAACTTTCTTGTCCATTATCAATTTTGAAGCTGCTCCATTCAACAACGAGGAGGCACAATGTATCATTGTGTCGAAGCTTATGTACTTGAGAGTTTTATCATTTTGTGACTTCCAAAGTTTGGATTCTTTGCCTGATTCAATAGGTAAATTGATCCATCTGCGCTATTTAGATCTTTCTCATTCAAGTGTAGAAACACTGCCAAAGTCATTGTGTAATTTATACAATCTGCAAACTTTGAAGTTGTGTAGTTGCAGAAAGCTGACTAAGTTGCCTAGTGACATGTGCAATCTTGTTAACTTGCGTCATCTTGAGATACGTGAAACTCCTATAGAAGAGATGCCGAGAGGAATGAGTAAATTAAATCATCTACAACATCTGGATTTCTTTGTTGTGGGCAAGCACAAAGAGAATGGGATCAAAGAATTGGGAGGACTTTCAAATCTTCGTGGTCGACTTAAAATTAGGAACTTGGAGAATGTTTCCCAAAGTGATGAAGCGTCGGAGGCAAGGATGATGGATAAAAAACACATTAATAGTTTATGGTTGGAATGGTCTAGATGTAATAACAACAGTACCAACTTCCAACTAGAAATAGATGTGCTTTGCAAGTTACAGCCTCACTTTAACATTGAATCGTTGAGAATAAAAGGCTATAAAGGAACCAGATTTCCAGATTGGATGGGAAATTCTTCCTACTGCAATATGATGAGTCTAAAATTGCGTGATTGTGACAACTGTAGTATGCTTCCTTCACTTGGACAACTACCTTCTCTCAAGGTCCTTAAGATTGCACGATTGAATAGGCTGAAGACTATTGATGCAGGTTTTTACAAGAACGAAGATTGTCGTTCTGGGACGCCCTTTCCCTCCCTTGAATCTCTGGCCATTCATCAAATGCCTTGTTGGGAGGTGTGGAGTTCCTTCGATTCAGAAGCTTTTCCTGTGCTTGAAATTCTTGAAATACGTGACTGCCCCAAACTAGAGGGAAGTTTGCCGAATCACCTTCCTGCTCTGAAAACACTTACAATTAGAAATTGTGAGCTGCTTGGCTCTTCTCTCCCAACGGCTCCCGCCATTCAAAGTTTGGAGATACGTAAAAGCAATAAAGTAGCACTGCATGCGTTTCCTCTCTTGGTAGAAACTATAAAAGTAGAAGGAAGCCCAATGGTGGAGTCCATGATGGAGGCCATCACAAACATCCAACCAACTTGTCTCCGGTCTTTAACATTAAGGGATTGCTCGTCAGCCGTGTCATTTCCGGGTGGTCGTTTACCTGAATCACTGAAGAGTCTGTATATCTCGGATCTTAAAAAACTGGAATTCCCGACGCAACACAAACATGAGTTACTGGAAACACTGTCAATAGAAAGCAGTTGTGATTCACTCACATCTCTTCCATTGGTTACCTTTCCAAATCTCAGAGATCTTGAAATCAGAAACTGTGAAAATATGGAATCTCTTTTGGTATCATTCTGGAGAGAAGGATTGCCTGCGCCCAACTTGATTACTTTCCAAGTGTGGGGCTCTGACAAGTTGAAGTCGTTGCCTGATGAGATGAGTACTCTTCTCCCAAAGTTAGAACGTCTCCTCATATCCAACTGCCCAGAAATTGAGTCGTTTCCAAAACGGGGTATGCCACCTAACCTGAGAATAGTTTGGATTTTCAATTGTGAGAAACTACTGAGCAGCCTAGCATGGCCATCCATGGGCATGCTTACTCATCTCTATGTTGGGGGTCGATGTGATGGCATCAAGTCCTTCCCTAAGGAGGGTTTGCTGCCTCCCTCCCTTACGTATCTGTATCTAAGTGGATTCTCAAATCTGGAGATGTTGGACTGCACGGGGCTTCTCCATCTCACATCCCTGCAACAATTAACCATAGACGGATGTCCTTTGCTGGAAAATATGGTGGGAGAAAGGCTTCCTGACTCTCTAATAAAATTAACCATAAAGAGTTGTCCTTTGCTGAAAAAACGATGCCGGAAGAAGCACCCTCAAATTTGGCCTAAAATTTCCCACATCCCTGGCATTAAGGTTGACAATAGATGGATTTAG


Protein sequences

Name Description Sequence
NB-LRR type disease resistance protein Rps1-k-1 NB-LRR type disease resistance protein Rps1-k-1 [Glycine max].

MAAALVGGAFLSAFLDVLFDRLASPDFVDLILGKKLSKKLLRKLETTLRVVGAVLDDAEKKQITNTNVKHWLNALKDAVYEADDLLDHVFTKAATQNKVRNLFSRFSDRKIVSKLEDIVVTLESHLKLKESLDLKESAVENLSWKAPSTSLEDGSHIYGREKDREAIIKLLSEDNSDGSEVSVVPIVGMGGVGKTTLAQLVYNDENLKEKFDFDFKAWVCVSQEFDVLKVTKTIIQAVTGNPCKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWSLLKKPFQCGIIRRSKILLTTRSEKTASVVQTVQTYHLNQLSNEDCWSVFANHACLSLESNENTTLEKIGKEIVKKCDGLPLAAQSLGGMLRRKHDIGDWYNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFDKNELILLWMAEDLLKKPRKGRTLEEVGHEYFDDLVSRSFFQRSSTNRSSWPYGECFVMHDLMHDLAKSLGGDFYFRSEELGKETKINTKTRHLSFTKFNSSVLDNFDVVGRAKFLRTFLSIINFEAAPFNNEEAQCIIVSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSHSSVETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMCNLVNLRHLEIRETPIEEMPRGMSKLNHLQHLDFFVVGKHKENGIKELGGLSNLRGRLKIRNLENVSQSDEASEARMMDKKHINSLWLEWSRCNNNSTNFQLEIDVLCKLQPHFNIESLRIKGYKGTRFPDWMGNSSYCNMMSLKLRDCDNCSMLPSLGQLPSLKVLKIARLNRLKTIDAGFYKNEDCRSGTPFPSLESLAIHQMPCWEVWSSFDSEAFPVLEILEIRDCPKLEGSLPNHLPALKTLTIRNCELLGSSLPTAPAIQSLEIRKSNKVALHAFPLLVETIKVEGSPMVESMMEAITNIQPTCLRSLTLRDCSSAVSFPGGRLPESLKSLYISDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRDLEIRNCENMESLLVSFWREGLPAPNLITFQVWGSDKLKSLPDEMSTLLPKLERLLISNCPEIESFPKRGMPPNLRIVWIFNCEKLLSSLAWPSMGMLTHLYVGGRCDGIKSFPKEGLLPPSLTYLYLSGFSNLEMLDCTGLLHLTSLQQLTIDGCPLLENMVGERLPDSLIKLTIKSCPLLKKRCRKKHPQIWPKISHIPGIKVDNRWI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
5-1106 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LVGGAFLSAFLDVLFDRLASPDFVDLILGKKLSKKLLRKLETTLRVVGAVLDDAEKKQITNTNVKHWLNALKDAVYEADDLLDHVFTKAATQNKVRNLFSRFSDRKIVSKLEDIVVTLESHLKLKESLDLKESAVENLSWKAPSTSLEDGSHIYGREKDREAIIKLLSEDNSDGSEVSVVPIVGMGGVGKTTLAQLVYNDENLKEKFDFDFKAWVCVSQEFDVLKVTKTIIQAVTGNPCKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWSLLKKPFQCGIIRRSKILLTTRSEKTASVVQTVQTYHLNQLSNEDCWSVFANHACLSLESNENTTLEKIGKEIVKKCDGLPLAAQSLGGMLRRKHDIGDWYNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFDKNELILLWMAEDLLKKPRKGRTLEEVGHEYFDDLVSRSFFQRSSTNRSSWPYGECFVMHDLMHDLAKSLGGDFYFRSEELGKETKINTKTRHLSFTKFNSSVLDNFDVVGRAKFLRTFLSIINFEAAPFNNEEAQCIIVSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSHSSVETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMCNLVNLRHLEIRETPIEEMPRGMSKLNHLQHLDFFVVGKHKENGIKELGGLSNLRGRLKIRNLENVSQSDEASEARMMDKKHINSLWLEWSRCNNNSTNFQLEIDVLCKLQPHFNIESLRIKGYKGTRFPDWMGNSSYCNMMSLKLRDCDNCSMLPSLGQLPSLKVLKIARLNRLKTIDAGFYKNEDCRSGTPFPSLESLAIHQMPCWEVWSSFDSEAFPVLEILEIRDCPKLEGSLPNHLPALKTLTIRNCELLGSSLPTAPAIQSLEIRKSNKVALHAFPLLVETIKVEGSPMVESMMEAITNIQPTCLRSLTLRDCSSAVSFPGGRLPESLKSLYISDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRDLEIRNCENMESLLVSFWREGLPAPNLITFQVWGSDKLKSLPDEMSTLLPKLERLLISNCPEIESFPKRGMPPNLRIVWIFNCEKLL

HMMPanther: PTHR23155
5-1106 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVGGAFLSAFLDVLFDRLASPDFVDLILGKKLSKKLLRKLETTLRVVGAVLDDAEKKQITNTNVKHWLNALKDAVYEADDLLDHVFTKAATQNKVRNLFSRFSDRKIVSKLEDIVVTLESHLKLKESLDLKESAVENLSWKAPSTSLEDGSHIYGREKDREAIIKLLSEDNSDGSEVSVVPIVGMGGVGKTTLAQLVYNDENLKEKFDFDFKAWVCVSQEFDVLKVTKTIIQAVTGNPCKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWSLLKKPFQCGIIRRSKILLTTRSEKTASVVQTVQTYHLNQLSNEDCWSVFANHACLSLESNENTTLEKIGKEIVKKCDGLPLAAQSLGGMLRRKHDIGDWYNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFDKNELILLWMAEDLLKKPRKGRTLEEVGHEYFDDLVSRSFFQRSSTNRSSWPYGECFVMHDLMHDLAKSLGGDFYFRSEELGKETKINTKTRHLSFTKFNSSVLDNFDVVGRAKFLRTFLSIINFEAAPFNNEEAQCIIVSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSHSSVETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMCNLVNLRHLEIRETPIEEMPRGMSKLNHLQHLDFFVVGKHKENGIKELGGLSNLRGRLKIRNLENVSQSDEASEARMMDKKHINSLWLEWSRCNNNSTNFQLEIDVLCKLQPHFNIESLRIKGYKGTRFPDWMGNSSYCNMMSLKLRDCDNCSMLPSLGQLPSLKVLKIARLNRLKTIDAGFYKNEDCRSGTPFPSLESLAIHQMPCWEVWSSFDSEAFPVLEILEIRDCPKLEGSLPNHLPALKTLTIRNCELLGSSLPTAPAIQSLEIRKSNKVALHAFPLLVETIKVEGSPMVESMMEAITNIQPTCLRSLTLRDCSSAVSFPGGRLPESLKSLYISDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRDLEIRNCENMESLLVSFWREGLPAPNLITFQVWGSDKLKSLPDEMSTLLPKLERLLISNCPEIESFPKRGMPPNLRIVWIFNCEKLL

superfamily: SSF52540
137-392 SSF52540

SAVENLSWKAPSTSLEDGSHIYGREKDREAIIKLLSEDNSDGSEVSVVPIVGMGGVGKTTLAQLVYNDENLKEKFDFDFKAWVCVSQEFDVLKVTKTIIQAVTGNPCKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWSLLKKPFQCGIIRRSKILLTTRSEKTASVVQTVQTYHLNQLSNEDCWSVFANHACLSLESNENTTLEKIGKEIVKKCDGLPLAAQSLGGMLRRKHDIGDWYNILNSDIWELSE

Gene3D: G3DSA:3.40.50.300
159-283 G3DSA:3.40.50.300

GREKDREAIIKLLSEDNSDGSEVSVVPIVGMGGVGKTTLAQLVYNDENLKEKFDFDFKAWVCVSQEFDVLKVTKTIIQAVTGNPCKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWSLLK

HMMPfam: PF00931
IPR002182
160-444 NB-ARC,NBS
NB-ARC

REKDREAIIKLLSEDNSDGSEVSVVPIVGMGGVGKTTLAQLVYNDENLKEKFDFDFKAWVCVSQEFDVLKVTKTIIQAVTGNPCKLNDLNLLHLELMDKLKDKKFLIVLDDVWTEDYVDWSLLKKPFQCGIIRRSKILLTTRSEKTASVVQTVQTYHLNQLSNEDCWSVFANHACLSLESNENTTLEKIGKEIVKKCDGLPLAAQSLGGMLRRKHDIGDWYNILNSDIWELSESECKVIPALRLSYHYLPPHLKRCFVYCSLYPQDYEFDKNELILLWMAEDLLK

FPrintScan: PR00364
IPR000767
183-198 DISEASERSIST
Disease resistance protein

VVPIVGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
258-272 DISEASERSIST
Disease resistance protein

KLKDKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CDGLPLAAQSLGGML

superfamily: SSF52058
486-897 SSF52058,LRR

VMHDLMHDLAKSLGGDFYFRSEELGKETKINTKTRHLSFTKFNSSVLDNFDVVGRAKFLRTFLSIINFEAAPFNNEEAQCIIVSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSHSSVETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMCNLVNLRHLEIRETPIEEMPRGMSKLNHLQHLDFFVVGKHKENGIKELGGLSNLRGRLKIRNLENVSQSDEASEARMMDKKHINSLWLEWSRCNNNSTNFQLEIDVLCKLQPHFNIESLRIKGYKGTRFPDWMGNSSYCNMMSLKLRDCDNCSMLPSLGQLPSLKVLKIARLNRLKTIDAGFYKNEDCRSGTPFPSLESLAIHQMPCWEVWSSFDSEAFPVLEILEIRDCPKLEGSLPNHLPALKTLTIRNCELLGSS

Gene3D: G3DSA:3.80.10.10
546-716 G3DSA:3.80.10.10

TFLSIINFEAAPFNNEEAQCIIVSKLMYLRVLSFCDFQSLDSLPDSIGKLIHLRYLDLSHSSVETLPKSLCNLYNLQTLKLCSCRKLTKLPSDMCNLVNLRHLEIRETPIEEMPRGMSKLNHLQHLDFFVVGKHKENGIKELGGLSNLRGRLKIRNLENVSQSDEASEARM

HMMPfam: PF13504
597-612 LRR_7,Leucine rich repeat

HLRYLDLSHSSVETLP

Gene3D: G3DSA:3.80.10.10
717-908 G3DSA:3.80.10.10

MDKKHINSLWLEWSRCNNNSTNFQLEIDVLCKLQPHFNIESLRIKGYKGTRFPDWMGNSSYCNMMSLKLRDCDNCSMLPSLGQLPSLKVLKIARLNRLKTIDAGFYKNEDCRSGTPFPSLESLAIHQMPCWEVWSSFDSEAFPVLEILEIRDCPKLEGSLPNHLPALKTLTIRNCELLGSSLPTAPAIQSLE

FPrintScan: PR00364
IPR000767
878-894 DISEASERSIST
Disease resistance protein

NHLPALKTLTIRNCELL

Gene3D: G3DSA:3.80.10.10
932-1068 G3DSA:3.80.10.10

SPMVESMMEAITNIQPTCLRSLTLRDCSSAVSFPGGRLPESLKSLYISDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRDLEIRNCENMESLLVSFWREGLPAPNLITFQVWGSDKLKSLPDEMSTLL

superfamily: SSF52058
948-1218 SSF52058,LRR

TCLRSLTLRDCSSAVSFPGGRLPESLKSLYISDLKKLEFPTQHKHELLETLSIESSCDSLTSLPLVTFPNLRDLEIRNCENMESLLVSFWREGLPAPNLITFQVWGSDKLKSLPDEMSTLLPKLERLLISNCPEIESFPKRGMPPNLRIVWIFNCEKLLSSLAWPSMGMLTHLYVGGRCDGIKSFPKEGLLPPSLTYLYLSGFSNLEMLDCTGLLHLTSLQQLTIDGCPLLENMVGERLPDSLIKLTIKSCPLLKKRCRKKHPQIWPKISH

Gene3D: G3DSA:3.80.10.10
1069-1201 G3DSA:3.80.10.10

PKLERLLISNCPEIESFPKRGMPPNLRIVWIFNCEKLLSSLAWPSMGMLTHLYVGGRCDGIKSFPKEGLLPPSLTYLYLSGFSNLEMLDCTGLLHLTSLQQLTIDGCPLLENMVGERLPDSLIKLTIKSCPLL


Diseases

Disease Pathogen Avirulence gene
Phytophthora root Phytophthora sojae

List of References

Hongyu Gao, Narayanan N Narayanan, Lori Ellison, Madan K Bhattacharyya
Two classes of highly similar coiled coil-nucleotide binding-leucine rich repeat genes isolated from the Rps1-k locus encode Phytophthora resistance in soybean.
Mol. Plant Microbe Interact.: 2005, 18(10);1035-45
PubMed:16255242 WorldCat.org DOI (P p)

Hongyu Gao, Madan K Bhattacharyya
The soybean-Phytophthora resistance locus Rps1-k encompasses coiled coil-nucleotide binding-leucine rich repeat-like genes and repetitive sequences.
BMC Plant Biol.: 2008, 8();29
PubMed:18366691 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox