PRGDB00035712 (LeEIX1)

From PRG Wiki
Jump to: navigation, search
LeEIX1
Gene Type Reference_R-Genes,_manually_curated
GenBank 39577519 (AY359965)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 7
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum EIX receptor 1 (Eix1) mRNA, complete cds.

DNA Sequence

ATGGACAAATGGAAATATGCAAGATTAGCACAGTTCCTTTTCACTTTGTCTCTACTGTTCCTAGAGACATCTTTTGGATTAGGTGGTAACAAGACCCTATGTTTAGATAAGGAGAGAGATGCTCTTCTTGAGTTCAAAAGAGGTCTTACTGATTCTTTTGATCATTTATCTACATGGGGTGATGAAGAAGATAAACAAGAATGCTGCAAATGGAAGGGTATTGAATGTGACAGAAGAACAGGTCATGTAACTGTTATTGATCTACACAATAAGTTTACTTGTTCTGCTGGTGCCAGTGCTTGTTTTGCTCCTAGATTGACAGGTAAACTTAGCCCTTCTCTGCTTGAGTTGGAGTACTTGAATTACTTGGACCTCAGTGTTAATGAATTTGAAAGAAGTGAAATACCAAGATTCATAGGCTCACTTAAGAGACTAGAGTACTTGAACCTGTCAGCTTCTTTTTTTTCTGGTGTAATTCCAATACAGTTCCAGAATCTAACTTCTTTAAGGACTCTTGATCTTGGAGAAAATAATCTTATAGTAAAGGACCTTAGATGGCTTTCTCATCTGTCTTCTCTAGAGTTTTTGAGTCTGAGTTCTAGCAACTTCCAAGTAAACAATTGGTTTCAAGAGATAACTAAGGTCCCTTCATTGAAAGAACTGGACTTGAGTGGCTGTGGACTCTCTAAGTTGGCTCCATCTCAAGCTGATTTAGCCAATTCTTCTTTTATATCTCTTTCTGTTCTTCATTTATGTTGTAATGAGTTTTCTTCTTCATCTGAATATAGCTGGGTATTCAATTTGACCACAAGCCTAACTAGCATTGACCTCCTTTATAATCAACTCAGCGGTCAAATTGATGATCGCTTTGGGACCTTGATGTATCTTGAACATCTTGATCTTGCTAATAACTTAAAGATTGAAGGTGGGGTTCCCAGTTCTTTTGGGAATTTGACACGTTTACGTCATCTGGACATGTCTAATACTCAGACAGTCCAATGGCTTCCTGAGTTGTTTCTCAGGTTATCAGGCAGTAGGAAATCACTTGAGGTTTTGGGGTTGAACGAAAACTCATTGTTTGGTTCAATTGTTAATGCAACAAGATTTTCATCCTTAAAGAAATTATACCTGCAGAAGAATATGCTGAATGGTTCTTTTATGGAAAGTGCGGGACAAGTTTCTACCCTTGAGTATCTGGATTTGTCTGAAAACCAAATGAGAGGGGCATTACCAGATTTAGCATTGTTTCCATCATTGAGAGAGTTGCATCTTGGCTCTAATCAATTTCGAGGGAGGATACCACAAGGTATCGGAAAACTTTCACAGCTTAGAATTTTGGATGTCTCGTCCAATAGACTGGAAGGACTACCAGAAAGTATGGGGCAACTATCTAATCTGGAAAGTTTTGATGCCTCTTACAATGTCCTGAAGGGAACAATTACTGAGTCCCACCTTTCAAACCTCTCCAGTTTAGTGGATTTGGACTTGTCATTCAACTCATTGGCTCTGAAGACGAGCTTCAATTGGCTTCCTCCTTTTCAGCTACAAGTTATAAGCCTGCCGTCTTGCAATTTGGGACCTTCTTTCCCAAAATGGCTTCAAAATCAGAACAACTATACTGTTCTTGATATCTCTCTTGCGAGTATTTCAGACACGCTTCCAAGTTGGTTCTCTAGCTTCCCCCCCGATCTAAAGATTTTGAATCTCTCAAACAACCAAATCAGTGGAAGAGTGTCTGACTTAATAGAGAATACATATGGGTACAGGGTTATAGATTTAAGCTATAACAACTTTTCAGGGGCTTTGCCACTAGTCCCTACCAATGTCCAAATATTTTACCTGCATAAAAATCAGTTTTTTGGATCCATCTCTTCAATTTGTCGAAGTAGAACATCTCCCACTTCTCTAGACTTGTCACACAATCAATTCTCAGGAGAACTTCCAGATTGTTGGATGAACATGACAAGTCTAGCTGTTCTTAATCTAGCTTATAACAATTTCTCTGGAGAAATTCCACATTCATTGGGTTCCTTGACAAATTTGAAGGCGTTATACATACGCCAAAACAGTTTAAGTGGAATGTTGCCTTCTTTTTCACAATGTCAGGGGTTGCAAATCTTGGATCTTGGAGGGAATAAGTTGACAGGAAGTATCCCTGGATGGATAGGGACTGATCTACTCAACTTGCGAATTCTAAGCCTGCGGTTCAACAGATTGCATGGCAGCATACCATCCATAATCTGTCAGCTTCAATTTCTTCAGATACTGGACCTTTCAGCGAATGGATTATCAGGGAAAATTCCACATTGCTTCAACAATTTCACCTTATTGTATCAAGATAATAATTCTGGTGAGCCAATGGAATTTATAGTTCAAGGTTTCTATGGTAAATTTCCTCGTCGTTACTTGTATATTGGTGACCTATTGGTTCAATGGAAAAATCAAGAGTCTGAGTACAAGAATCCTTTATTATATCTGAAGACTATTGATCTTTCAAGTAATGAATTAATTGGAGGTGTTCCTAAAGAAATAGCTGATATGAGAGGATTGAAATCTTTGAACCTCTCAAGAAATGAGCTGAATGGAACTGTCATTGAAGGAATAGGTCAAATGAGGATGTTGGAGTCTCTTGACATGTCAAGAAACCAGCTTTCTGGTGTGATACCGCAAGATCTTGCTAATTTGACTTTTCTTAGTGTGTTGGACTTGTCGAACAACCAGTTATCAGGGAGAATTCCATCAAGCACTCAACTGCAAAGTTTTGATAGATCATCCTACAGTGATAATGCTCAACTCTGTGGGCCTCCTCTTCAGGAGTGTCCTGGATATGCTCCTCCTAGCCCCCTTATTGATCATGGCAGCAACAACAATCCACAAGAACATGATGAGGAGGAGGAGTTTCCATCTCTGGAGTTTTATATATCAATGGTGCTAAGCTTTTTTGTTGCATTTTGGGGAATTTTGGGCTGTTTAATTGTCAATAGTTCTTGGAGGAATGCCTACTTCAAATTCTTGACGGACACGACAAGTTGGCTCGATATGATATCAAGAGTCTGGTTTGCAAGACTCAAGAAAAAGCTGAGGAGGGCCCGATGA


Protein sequences

Name Description Sequence
EIX receptor 1 EIX receptor 1 [Lycopersicon esculentum].

MDKWKYARLAQFLFTLSLLFLETSFGLGGNKTLCLDKERDALLEFKRGLTDSFDHLSTWGDEEDKQECCKWKGIECDRRTGHVTVIDLHNKFTCSAGASACFAPRLTGKLSPSLLELEYLNYLDLSVNEFERSEIPRFIGSLKRLEYLNLSASFFSGVIPIQFQNLTSLRTLDLGENNLIVKDLRWLSHLSSLEFLSLSSSNFQVNNWFQEITKVPSLKELDLSGCGLSKLAPSQADLANSSFISLSVLHLCCNEFSSSSEYSWVFNLTTSLTSIDLLYNQLSGQIDDRFGTLMYLEHLDLANNLKIEGGVPSSFGNLTRLRHLDMSNTQTVQWLPELFLRLSGSRKSLEVLGLNENSLFGSIVNATRFSSLKKLYLQKNMLNGSFMESAGQVSTLEYLDLSENQMRGALPDLALFPSLRELHLGSNQFRGRIPQGIGKLSQLRILDVSSNRLEGLPESMGQLSNLESFDASYNVLKGTITESHLSNLSSLVDLDLSFNSLALKTSFNWLPPFQLQVISLPSCNLGPSFPKWLQNQNNYTVLDISLASISDTLPSWFSSFPPDLKILNLSNNQISGRVSDLIENTYGYRVIDLSYNNFSGALPLVPTNVQIFYLHKNQFFGSISSICRSRTSPTSLDLSHNQFSGELPDCWMNMTSLAVLNLAYNNFSGEIPHSLGSLTNLKALYIRQNSLSGMLPSFSQCQGLQILDLGGNKLTGSIPGWIGTDLLNLRILSLRFNRLHGSIPSIICQLQFLQILDLSANGLSGKIPHCFNNFTLLYQDNNSGEPMEFIVQGFYGKFPRRYLYIGDLLVQWKNQESEYKNPLLYLKTIDLSSNELIGGVPKEIADMRGLKSLNLSRNELNGTVIEGIGQMRMLESLDMSRNQLSGVIPQDLANLTFLSVLDLSNNQLSGRIPSSTQLQSFDRSSYSDNAQLCGPPLQECPGYAPPSPLIDHGSNNNPQEHDEEEEFPSLEFYISMVLSFFVAFWGILGCLIVNSSWRNAYFKFLTDTTSWLDMISRVWFARLKKKLRRAR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
2-999 PTHR24420:SF473,SUBFAMILY NOT NAMED

DKWKYARLAQFLFTLSLLFLETSFGLGGNKTLCLDKERDALLEFKRGLTDSFDHLSTWGDEEDKQECCKWKGIECDRRTGHVTVIDLHNKFTCSAGASACFAPRLTGKLSPSLLELEYLNYLDLSVNEFERSEIPRFIGSLKRLEYLNLSASFFSGVIPIQFQNLTSLRTLDLGENNLIVKDLRWLSHLSSLEFLSLSSSNFQVNNWFQEITKVPSLKELDLSGCGLSKLAPSQADLANSSFISLSVLHLCCNEFSSSSEYSWVFNLTTSLTSIDLLYNQLSGQIDDRFGTLMYLEHLDLANNLKIEGGVPSSFGNLTRLRHLDMSNTQTVQWLPELFLRLSGSRKSLEVLGLNENSLFGSIVNATRFSSLKKLYLQKNMLNGSFMESAGQVSTLEYLDLSENQMRGALPDLALFPSLRELHLGSNQFRGRIPQGIGKLSQLRILDVSSNRLEGLPESMGQLSNLESFDASYNVLKGTITESHLSNLSSLVDLDLSFNSLALKTSFNWLPPFQLQVISLPSCNLGPSFPKWLQNQNNYTVLDISLASISDTLPSWFSSFPPDLKILNLSNNQISGRVSDLIENTYGYRVIDLSYNNFSGALPLVPTNVQIFYLHKNQFFGSISSICRSRTSPTSLDLSHNQFSGELPDCWMNMTSLAVLNLAYNNFSGEIPHSLGSLTNLKALYIRQNSLSGMLPSFSQCQGLQILDLGGNKLTGSIPGWIGTDLLNLRILSLRFNRLHGSIPSIICQLQFLQILDLSANGLSGKIPHCFNNFTLLYQDNNSGEPMEFIVQGFYGKFPRRYLYIGDLLVQWKNQESEYKNPLLYLKTIDLSSNELIGGVPKEIADMRGLKSLNLSRNELNGTVIEGIGQMRMLESLDMSRNQLSGVIPQDLANLTFLSVLDLSNNQLSGRIPSSTQLQSFDRSSYSDNAQLCGPPLQECPGYAPPSPLIDHGSNNNPQEHDEEEEFPSLEFYISMVLSFFVAFWGILGCLIVNSSWRN

HMMPanther: PTHR24420
2-999 PTHR24420,FAMILY NOT NAMED

DKWKYARLAQFLFTLSLLFLETSFGLGGNKTLCLDKERDALLEFKRGLTDSFDHLSTWGDEEDKQECCKWKGIECDRRTGHVTVIDLHNKFTCSAGASACFAPRLTGKLSPSLLELEYLNYLDLSVNEFERSEIPRFIGSLKRLEYLNLSASFFSGVIPIQFQNLTSLRTLDLGENNLIVKDLRWLSHLSSLEFLSLSSSNFQVNNWFQEITKVPSLKELDLSGCGLSKLAPSQADLANSSFISLSVLHLCCNEFSSSSEYSWVFNLTTSLTSIDLLYNQLSGQIDDRFGTLMYLEHLDLANNLKIEGGVPSSFGNLTRLRHLDMSNTQTVQWLPELFLRLSGSRKSLEVLGLNENSLFGSIVNATRFSSLKKLYLQKNMLNGSFMESAGQVSTLEYLDLSENQMRGALPDLALFPSLRELHLGSNQFRGRIPQGIGKLSQLRILDVSSNRLEGLPESMGQLSNLESFDASYNVLKGTITESHLSNLSSLVDLDLSFNSLALKTSFNWLPPFQLQVISLPSCNLGPSFPKWLQNQNNYTVLDISLASISDTLPSWFSSFPPDLKILNLSNNQISGRVSDLIENTYGYRVIDLSYNNFSGALPLVPTNVQIFYLHKNQFFGSISSICRSRTSPTSLDLSHNQFSGELPDCWMNMTSLAVLNLAYNNFSGEIPHSLGSLTNLKALYIRQNSLSGMLPSFSQCQGLQILDLGGNKLTGSIPGWIGTDLLNLRILSLRFNRLHGSIPSIICQLQFLQILDLSANGLSGKIPHCFNNFTLLYQDNNSGEPMEFIVQGFYGKFPRRYLYIGDLLVQWKNQESEYKNPLLYLKTIDLSSNELIGGVPKEIADMRGLKSLNLSRNELNGTVIEGIGQMRMLESLDMSRNQLSGVIPQDLANLTFLSVLDLSNNQLSGRIPSSTQLQSFDRSSYSDNAQLCGPPLQECPGYAPPSPLIDHGSNNNPQEHDEEEEFPSLEFYISMVLSFFVAFWGILGCLIVNSSWRN

Gene3D: G3DSA:3.80.10.10
34-336 G3DSA:3.80.10.10

CLDKERDALLEFKRGLTDSFDHLSTWGDEEDKQECCKWKGIECDRRTGHVTVIDLHNKFTCSAGASACFAPRLTGKLSPSLLELEYLNYLDLSVNEFERSEIPRFIGSLKRLEYLNLSASFFSGVIPIQFQNLTSLRTLDLGENNLIVKDLRWLSHLSSLEFLSLSSSNFQVNNWFQEITKVPSLKELDLSGCGLSKLAPSQADLANSSFISLSVLHLCCNEFSSSSEYSWVFNLTTSLTSIDLLYNQLSGQIDDRFGTLMYLEHLDLANNLKIEGGVPSSFGNLTRLRHLDMSNTQTVQWLP

HMMPfam: PF08263
IPR013210
36-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DKERDALLEFKRGLTDSFDHLSTWGDEEDKQECCKWKGIECD

superfamily: SSF52058
59-336 SSF52058,LRR

WGDEEDKQECCKWKGIECDRRTGHVTVIDLHNKFTCSAGASACFAPRLTGKLSPSLLELEYLNYLDLSVNEFERSEIPRFIGSLKRLEYLNLSASFFSGVIPIQFQNLTSLRTLDLGENNLIVKDLRWLSHLSSLEFLSLSSSNFQVNNWFQEITKVPSLKELDLSGCGLSKLAPSQADLANSSFISLSVLHLCCNEFSSSSEYSWVFNLTTSLTSIDLLYNQLSGQIDDRFGTLMYLEHLDLANNLKIEGGVPSSFGNLTRLRHLDMSNTQTVQWLP

HMMPfam: PF13855
144-202 LRR_8,Leucine rich repeat

RLEYLNLSASFFSGVIPIQFQNLTSLRTLDLGENNLIVKDLRWLSHLSSLEFLSLSSSN

ProfileScan: PS51450
IPR001611
168-191 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRTLDLGENNLIVKDLRWLSHLS

HMMPfam: PF13504
216-231 LRR_7,Leucine rich repeat

PSLKELDLSGCGLSKL

ProfileScan: PS51450
IPR001611
217-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKELDLSGCGLSKLAPSQADL

ProfileScan: PS51450
IPR001611
245-266 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLHLCCNEFSSSSEYSWVF

ProfileScan: PS51450
IPR001611
271-293 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSIDLLYNQLSGQIDDRFGTL

ProfileScan: PS51450
IPR001611
295-314 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLEHLDLANNLKIEGGVPSS

HMMPfam: PF00560
IPR001611
296-318 LRR_1
Leucine-rich repeat

LEHLDLANNLKIEGGVPSSFGNL

superfamily: SSF52047
310-599 SSF52047,LRR

GVPSSFGNLTRLRHLDMSNTQTVQWLPELFLRLSGSRKSLEVLGLNENSLFGSIVNATRFSSLKKLYLQKNMLNGSFMESAGQVSTLEYLDLSENQMRGALPDLALFPSLRELHLGSNQFRGRIPQGIGKLSQLRILDVSSNRLEGLPESMGQLSNLESFDASYNVLKGTITESHLSNLSSLVDLDLSFNSLALKTSFNWLPPFQLQVISLPSCNLGPSFPKWLQNQNNYTVLDISLASISDTLPSWFSSFPPDLKILNLSNNQISGRVSDLIENTYGYRVIDLSYNNFS

Gene3D: G3DSA:3.80.10.10
347-423 G3DSA:3.80.10.10

KSLEVLGLNENSLFGSIVNATRFSSLKKLYLQKNMLNGSFMESAGQVSTLEYLDLSENQMRGALPDLALFPSLRELH

ProfileScan: PS51450
IPR001611
395-417 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEYLDLSENQMRGALPDLALFP

ProfileScan: PS51450
IPR001611
418-441 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRELHLGSNQFRGRIPQGIGKLS

Gene3D: G3DSA:3.80.10.10
424-612 G3DSA:3.80.10.10

LGSNQFRGRIPQGIGKLSQLRILDVSSNRLEGLPESMGQLSNLESFDASYNVLKGTITESHLSNLSSLVDLDLSFNSLALKTSFNWLPPFQLQVISLPSCNLGPSFPKWLQNQNNYTVLDISLASISDTLPSWFSSFPPDLKILNLSNNQISGRVSDLIENTYGYRVIDLSYNNFSGALPLVPTNVQIF

HMMSmart: SM00369
IPR003591
440-463 LRR_TYP
Leucine-rich repeat, typical subtype

LSQLRILDVSSNRLEGLPESMGQL

HMMPfam: PF13855
441-501 LRR_8,Leucine rich repeat

SQLRILDVSSNRLEGLPESMGQLSNLESFDASYNVLKGTITESHLSNLSSLVDLDLSFNSL

ProfileScan: PS51450
IPR001611
442-463 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRILDVSSNRLEGLPESMGQL

ProfileScan: PS51450
IPR001611
465-486 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLESFDASYNVLKGTITESHLS

ProfileScan: PS51450
IPR001611
490-511 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVDLDLSFNSLALKTSFNWLP

ProfileScan: PS51450
IPR001611
563-585 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLKILNLSNNQISGRVSDLIENT

superfamily: SSF52058
605-941 SSF52058,LRR

VPTNVQIFYLHKNQFFGSISSICRSRTSPTSLDLSHNQFSGELPDCWMNMTSLAVLNLAYNNFSGEIPHSLGSLTNLKALYIRQNSLSGMLPSFSQCQGLQILDLGGNKLTGSIPGWIGTDLLNLRILSLRFNRLHGSIPSIICQLQFLQILDLSANGLSGKIPHCFNNFTLLYQDNNSGEPMEFIVQGFYGKFPRRYLYIGDLLVQWKNQESEYKNPLLYLKTIDLSSNELIGGVPKEIADMRGLKSLNLSRNELNGTVIEGIGQMRMLESLDMSRNQLSGVIPQDLANLTFLSVLDLSNNQLSGRIPSSTQLQSFDRSSYSDNAQLCGPPLQECP

Gene3D: G3DSA:3.80.10.10
613-779 G3DSA:3.80.10.10

YLHKNQFFGSISSICRSRTSPTSLDLSHNQFSGELPDCWMNMTSLAVLNLAYNNFSGEIPHSLGSLTNLKALYIRQNSLSGMLPSFSQCQGLQILDLGGNKLTGSIPGWIGTDLLNLRILSLRFNRLHGSIPSIICQLQFLQILDLSANGLSGKIPHCFNNFTLLYQ

ProfileScan: PS51450
IPR001611
656-679 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAVLNLAYNNFSGEIPHSLGSLT

HMMPfam: PF13855
656-714 LRR_8,Leucine rich repeat

SLAVLNLAYNNFSGEIPHSLGSLTNLKALYIRQNSLSGMLPSFSQCQGLQILDLGGNKL

ProfileScan: PS51450
IPR001611
680-702 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKALYIRQNSLSGMLPSFSQCQ

ProfileScan: PS51450
IPR001611
703-725 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQILDLGGNKLTGSIPGWIGTD

ProfileScan: PS51450
IPR001611
728-750 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRILSLRFNRLHGSIPSIICQL

HMMPfam: PF00560
IPR001611
728-747 LRR_1
Leucine-rich repeat

NLRILSLRFNRLHGSIPSII

ProfileScan: PS51450
IPR001611
752-774 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLQILDLSANGLSGKIPHCFNNF

HMMPfam: PF00560
IPR001611
753-773 LRR_1
Leucine-rich repeat

LQILDLSANGLSGKIPHCFNN

Gene3D: G3DSA:3.80.10.10
829-939 G3DSA:3.80.10.10

IDLSSNELIGGVPKEIADMRGLKSLNLSRNELNGTVIEGIGQMRMLESLDMSRNQLSGVIPQDLANLTFLSVLDLSNNQLSGRIPSSTQLQSFDRSSYSDNAQLCGPPLQE

ProfileScan: PS51450
IPR001611
849-872 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLKSLNLSRNELNGTVIEGIGQMR

ProfileScan: PS51450
IPR001611
873-896 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLESLDMSRNQLSGVIPQDLANLT

HMMPfam: PF12799
874-909 LRR_4,Leucine Rich repeats (2 copies)

LESLDMSRNQLSGVIPQDLANLTFLSVLDLSNNQLS

FPrintScan: PR00019
874-887 LEURICHRPT,Leucine-rich repeat signature

LESLDMSRNQLSGV

FPrintScan: PR00019
895-908 LEURICHRPT,Leucine-rich repeat signature

LTFLSVLDLSNNQL

ProfileScan: PS51450
IPR001611
897-919 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSVLDLSNNQLSGRIPSSTQLQ


Diseases

Disease Pathogen Avirulence gene
Eliciting Fungus Fungal ethylene-inducing xylanase

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox