PRGDB00035715 (Bs3-E)

From PRG Wiki
Jump to: navigation, search
Bs3-E
Gene Type Reference_R-Genes,_manually_curated
GenBank 158851512 (EU078683)
Gene Class Other
Domain Type NBS
Gene Species Capsicum annuum

Comment?

Capsicum annuum cultivar ECW Bs3-E (Bs3-E) gene, complete cds.

DNA Sequence

ATGATGAATCAGAATTGCTTTAATTCTTGTTCACCTCTAACTGTTGATGCACTTGAACCAAAAAAATCCTCTTGTGCTGCTAAATGCATACAAGTAAATGGTCCTCTTATTGTTGGAGCTGGCCCTTCAGGCCTGGCTACTGCTGCCGTCCTTAAGCAATACAGTGTTCCGTATGTAATCATTGAACGCGCGGACTGCATTGCTTCTCTGTGGCAACACAAGACCTACGATCGGCTTAGGCTTAACGTGCCACGACAATACTGCGAATTGCCTGGCTTGCCATTTCCACCAGACTTTCCAGAGTATCCAACCAAAAACCAATTCATCAGCTACCTCGTATCTTATGCAAAGCATTTCGAGATCAAACCACAACTCAACGAGTCAGTAAACTTAGCTGGATATGATGAGACATGTGGTTTATGGAAGGTGAAAACAGTTTCTGAAATCAATGGTTCAACCTCTGAATACATGTGTAAGTGGCTTATTGTGGCCACAGGAGAGAATGCTGAGATGATAGTGCCCGAATTCGAAGGATTGCAAGATTTTGGTGGCCAGGTTATTCATGCTTGTGAGTACAAGACTGGGGAATACTATACTGGAGAAAATGTGCTGGCGGTTGGCTGTGGCAATTCCGGGATCGATATCTCACTTGATCTTTCCCAACATAATGCAAATCCATTCATGGTAGTTCGAAGCTCGGTACAGGGTCGTAATTTCCCTGAGGAAATAAACATAGTTCCAGCAATCAAGAAATTTACTCAAGGAAAAGTAGAATTTGTTAATGGACAAATTCTAGAGATCGACTCTGTTATCTTGGCAACTGGTTATACCAGCAATGTAACTTCTTGGTTAATGGAGAGTGAATTTTTTTCAAGGGAGGGATGTCCAAAAAGCCCATTCCCAAATGGTTGGAAGGGGGAGGATGGTCTCTATGCAGTTGGATTTACAGGAATAGGACTGTTTGGTGCTTCTATAGATGCCACTAATGTTGCACAAGATATTGCCAAAATTTGGAAAGAACAAATGTAG


Protein sequences

Name Description Sequence
Bs3-E Bs3-E [Capsicum annuum].

MMNQNCFNSCSPLTVDALEPKKSSCAAKCIQVNGPLIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESEFFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWKEQM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023
1-342 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

MMNQNCFNSCSPLTVDALEPKKSSCAAKCIQVNGPLIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESEFFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWKEQM

HMMPanther: PTHR23023:SF5
1-342 PTHR23023:SF5,MONOOXYGENASE

MMNQNCFNSCSPLTVDALEPKKSSCAAKCIQVNGPLIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESEFFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWKEQM

FPrintScan: PR00469
IPR000103
34-56 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPLIVGAGPSGLATAAVLKQYSV

FPrintScan: PR00368
IPR013027
35-54 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PLIVGAGPSGLATAAVLKQY

superfamily: SSF51905
36-242 SSF51905

LIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEE

Gene3D: G3DSA:3.50.50.60
37-214 G3DSA:3.50.50.60

IVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGID

HMMPfam: PF00743
IPR020946
37-231 FMO-like
Flavin monooxygenase-like

IVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVR

ProfileScan: PS01180
IPR000859
138-246 CUB
CUB

CGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIV

FPrintScan: PR00368
IPR013027
158-176 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

CKWLIVATGENAEMIVPEF

FPrintScan: PR00469
IPR000103
198-222 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

YTGENVLAVGCGNSGIDISLDLSQH

FPrintScan: PR00368
IPR013027
202-220 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

NVLAVGCGNSGIDISLDLS

Gene3D: G3DSA:3.50.50.60
215-268 G3DSA:3.50.50.60

ISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEID

superfamily: SSF51905
249-336 SSF51905

IKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESEFFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAK

FPrintScan: PR00368
IPR013027
267-283 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

IDSVILATGYTSNVTSW

Gene3D: G3DSA:3.50.50.60
269-339 G3DSA:3.50.50.60

SVILATGYTSNVTSWLMESEFFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWK


Diseases

Disease Pathogen Avirulence gene
Bacterial Spot Xanthomonas campestris pv. vesicatoria str. 85-10 PRGAV00000049

List of References

Patrick Römer, Simone Hahn, Tina Jordan, Tina Strauss, Ulla Bonas, Thomas Lahaye
Plant pathogen recognition mediated by promoter activation of the pepper Bs3 resistance gene.
Science: 2007, 318(5850);645-8
PubMed:17962564 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox