PRGDB00035719 (EFR)

From PRG Wiki
Jump to: navigation, search
EFR
Gene Type Reference_R-Genes,_manually_curated
GenBank 145358269 (NM_122055)
Gene Class RLK
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 5
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana EFR (EF-TU RECEPTOR); ATP binding / kinase/ protein serine/threonine kinase (EFR) mRNA, complete cds.

DNA Sequence

ATGAAGCTGTCCTTTTCACTTGTTTTCAATGCTCTCACGTTGCTTCTTCAAGTTTGCATCTTTGCTCAAGCCAGGTTTTCTAATGAGACTGATATGCAAGCTTTGCTTGAGTTCAAGTCTCAAGTTTCTGAAAACAACAAGAGAGAGGTCTTGGCTTCATGGAATCACTCCTCCCCATTTTGTAATTGGATTGGAGTCACATGTGGCCGCAGGAGAGAAAGAGTTATAAGTTTGAACCTTGGAGGATTCAAGTTAACCGGTGTGATCTCACCCTCCATTGGTAATCTCTCCTTTCTTAGATTACTTAATCTTGCAGACAACTCTTTTGGAAGTACCATCCCTCAAAAGGTGGGAAGGCTATTTAGGCTTCAGTACTTGAACATGAGCTATAATCTTCTCGAAGGAAGGATTCCGTCTAGTCTTTCTAACTGCTCTAGACTGTCGACCGTTGATTTATCGTCAAACCATCTTGGACATGGTGTTCCTTCAGAACTAGGTTCACTTTCTAAGCTTGCCATTCTGGATCTTAGCAAAAACAACCTTACTGGAAATTTTCCTGCATCTTTAGGAAACTTGACGTCACTTCAGAAGCTTGACTTTGCATATAACCAGATGAGAGGTGAGATTCCAGACGAAGTAGCTAGATTGACTCAAATGGTGTTTTTCCAAATAGCACTGAATAGTTTTTCAGGTGGTTTTCCTCCTGCATTGTACAACATCTCCTCTCTTGAGTCTCTATCTCTAGCTGACAATAGCTTTTCGGGTAATCTTAGGGCTGATTTTGGTTATCTTCTACCAAATCTAAGAAGACTTCTTTTGGGAACAAATCAGTTCACTGGAGCTATTCCCAAAACACTTGCCAATATCTCAAGCCTTGAAAGGTTTGATATCTCATCTAATTACCTGTCTGGTAGTATCCCTTTGAGCTTTGGAAAGTTACGTAATCTGTGGTGGTTAGGGATTCGTAATAACTCTCTTGGAAATAACTCGTCCAGTGGTCTTGAATTTATTGGGGCTGTGGCGAACTGCACTCAATTAGAGTACTTAGATGTTGGTTACAATAGACTTGGAGGTGAGCTTCCTGCTTCTATAGCCAATCTGTCCACTACATTGACTAGTCTGTTCCTTGGACAAAATCTTATCTCTGGAACCATTCCTCATGACATCGGGAATCTTGTAAGCCTGCAAGAACTCAGCTTAGAAACAAATATGTTGAGTGGAGAACTTCCCGTCTCTTTCGGGAAGCTTTTGAACTTGCAGGTTGTGGATCTGTATTCAAATGCAATATCGGGGGAAATACCATCTTATTTTGGCAACATGACTCGGTTGCAGAAGCTCCATTTGAATAGCAATAGTTTCCACGGAAGAATCCCTCAGAGTCTTGGACGTTGTCGATACTTGCTAGACCTGTGGATGGATACAAATAGGTTGAATGGGACTATACCTCAGGAAATACTGCAAATTCCATCCCTCGCTTACATAGATTTGTCAAACAATTTCTTGACAGGCCATTTTCCAGAAGAAGTTGGAAAGTTAGAACTTCTTGTTGGACTAGGTGCTTCGTACAACAAATTATCAGGAAAGATGCCACAAGCTATAGGGGGTTGTCTTTCGATGGAATTTCTCTTTATGCAAGGAAATTCGTTTGACGGAGCCATTCCAGATATAAGCCGGTTGGTAAGCCTAAAGAATGTTGACTTCTCCAACAACAATCTCTCTGGCCGGATACCTCGATATCTGGCCAGTCTTCCTTCGCTGCGAAATCTGAATCTTTCTATGAACAAGTTTGAGGGAAGGGTGCCAACAACAGGAGTGTTTCGAAATGCTACAGCAGTTTCTGTTTTTGGTAACACAAATATTTGCGGAGGCGTCCGAGAAATGCAACTAAAGCCATGCATTGTACAGGCATCTCCAAGGAAGAGAAAGCCTCTGTCAGTTAGAAAGAAAGTTGTCAGTGGTATTTGTATAGGTATAGCTTCGCTTTTGTTAATCATAATTGTGGCTTCTCTGTGTTGGTTCATGAAGAGGAAAAAGAAAAACAATGCCAGTGATGGTAACCCATCTGATTCTACTACTTTGGGGATGTTCCATGAGAAGGTAAGTTATGAAGAGCTTCATAGTGCAACAAGTCGCTTCTCTTCAACCAATTTGATTGGTTCAGGCAATTTCGGTAATGTGTTTAAAGGATTGCTTGGCCCTGAGAATAAACTCGTCGCGGTTAAAGTTTTGAACCTCCTAAAGCATGGAGCGACGAAAAGCTTTATGGCGGAATGTGAAACCTTCAAGGGTATACGACATCGTAACCTTGTAAAACTGATAACGGTTTGTTCAAGCCTTGATTCCGAGGGAAATGATTTCAGAGCTCTGGTCTATGAGTTCATGCCAAAAGGAAGTCTGGATATGTGGCTGCAGCTAGAAGATCTGGAAAGGGTAAACGATCACTCGAGATCTTTAACACCCGCAGAGAAACTCAACATAGCAATAGATGTGGCTTCAGCTTTGGAGTATCTGCACGTTCATTGTCATGACCCTGTAGCTCACTGTGATATTAAGCCAAGCAACATTCTTCTAGACGATGATCTGACTGCTCATGTTAGTGACTTTGGTTTGGCTCAGCTCCTCTATAAATACGATCGAGAATCCTTTCTAAACCAGTTTAGTTCTGCTGGTGTCAGAGGCACCATTGGCTATGCCGCGCCAGAGTATGGAATGGGAGGCCAACCATCAATACAAGGAGATGTGTACAGCTTCGGAATTCTACTTTTGGAGATGTTTAGTGGAAAGAAACCAACAGATGAATCATTTGCAGGCGATTATAACCTCCACAGCTACACAAAGTCTATATTATCGGGTTGCACGAGCAGTGGAGGCAGCAACGCCATTGATGAGGGGTTGAGACTGGTTTTGCAGGTGGGGATAAAGTGTTCTGAAGAATATCCGAGGGATAGGATGAGAACGGATGAAGCAGTACGAGAATTAATCTCAATAAGATCTAAGTTCTTCAGTTCCAAGACGACTATTACAGAGAGTCCTCGAGATGCTCCGCAAAGTTCTCCTCAGGAATGGATGTTAAATACGGACATGCATACTATGTAG


Protein sequences

Name Description Sequence
EFR (EF-TU RECEPTOR); ATP binding / kinase/ protein serine/threonine kinase EFR (EF-TU RECEPTOR); ATP binding / kinase/ protein serine/threonine kinase [Arabidopsis thaliana].

MKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTITESPRDAPQSSPQEWMLNTDMHTM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-997 PTHR24420:SF474,SUBFAMILY NOT NAMED

MKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIR

HMMPanther: PTHR24420
1-997 PTHR24420,FAMILY NOT NAMED

MKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASPRKRKPLSVRKKVVSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIR

superfamily: SSF52058
25-324 SSF52058,LRR

RFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNN

Gene3D: G3DSA:3.80.10.10
29-248 G3DSA:3.80.10.10

ETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSL

HMMPfam: PF08263
IPR013210
29-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTC

HMMPfam: PF00560
IPR001611
122-144 LRR_1
Leucine-rich repeat

RLQYLNMSYNLLEGRIPSSLSNC

HMMPfam: PF13855
145-204 LRR_8,Leucine rich repeat

SRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQ

Gene3D: G3DSA:3.80.10.10
249-368 G3DSA:3.80.10.10

ADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLS

HMMPfam: PF00560
IPR001611
291-313 LRR_1
Leucine-rich repeat

SLERFDISSNYLSGSIPLSFGKL

HMMPfam: PF13516
343-366 LRR_6,Leucine Rich repeat

CTQLEYLDVGYNRLGGELPASIAN

superfamily: SSF52058
369-622 SSF52058,LRR

TTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICG

Gene3D: G3DSA:3.80.10.10
369-621 G3DSA:3.80.10.10

TTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNIC

HMMPfam: PF00560
IPR001611
490-511 LRR_1
Leucine-rich repeat

SLAYIDLSNNFLTGHFPEEVGK

Gene3D: G3DSA:3.30.200.20
663-795 G3DSA:3.30.200.20

LIIIVASLCWFMKRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMP

superfamily: SSF56112
IPR011009
684-1016 Kinase_like
Protein kinase-like domain

DGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTITESPRDAPQ

ProfileScan: PS50011
IPR000719
712-1001 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFF

HMMPfam: PF00069
IPR000719
715-950 Pkinase,Ser-thr
Protein kinase, catalytic domain

TNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILS

PatternScan: PS00107
IPR017441
718-741 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGNFGNVFKGLLGPENKLVAVK

Gene3D: G3DSA:1.10.510.10
811-1008 G3DSA:1.10.510.10

VNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTIT

PatternScan: PS00108
IPR008271
845-857 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHCDIKPSNILL


Diseases

Disease Pathogen Avirulence gene
Eliciting Bacteria Bacteria with flagellum




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox