PRGDB00035720 (PEPR1)

From PRG Wiki
Jump to: navigation, search
PEPR1
Gene Type Reference_R-Genes,_manually_curated
GenBank 18410260 (NM_105966)
Gene Class RLK
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 1
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana PEPR1 (PEP1 RECEPTOR 1); ATP binding / kinase/ protein binding / protein serine/threonine kinase (PEPR1) mRNA, complete cds.

DNA Sequence

ATGAAGAATCTTGGGGGGTTGTTCAAAATTCTTCTGCTTTTCTTCTGTCTCTTTCTATCGACCCACATAATTTCCGTTTCTTGTTTAAACTCAGATGGGCTAACTCTACTCTCTCTTCTGAAGCATTTGGATAGAGTACCACCACAAGTTACTTCGACATGGAAAATAAACGCATCTGAAGCAACTCCATGTAACTGGTTCGGTATCACTTGTGACGATTCTAAGAATGTTGCGTCTCTCAACTTCACTCGTTCTAGGGTTTCAGGTCAATTGGGTCCGGAAATTGGGGAGCTCAAAAGCTTGCAGATTTTGGATCTGAGTACTAACAATTTCTCCGGGACTATACCTTCCACTTTAGGAAACTGTACCAAACTCGCTACTCTAGATTTGTCTGAAAATGGATTCTCTGATAAGATCCCAGATACTCTCGATAGCTTGAAGAGGTTGGAGGTGCTTTATCTTTACATAAACTTCCTCACTGGTGAGTTACCTGAATCCTTGTTTCGAATTCCGAAGCTGCAGGTTTTATATCTTGACTATAACAATCTCACCGGTCCGATTCCTCAAAGTATTGGTGATGCTAAGGAGCTTGTGGAGCTGAGTATGTATGCGAATCAGTTCTCTGGTAACATCCCTGAGTCGATTGGGAATAGCAGTAGTCTGCAGATTCTTTATTTGCACAGGAACAAGTTAGTTGGTTCATTACCTGAAAGTCTCAATCTTTTGGGGAATCTCACTACTCTGTTTGTTGGTAACAACAGTCTACAAGGGCCGGTTCGTTTCGGATCACCTAATTGCAAGAATTTGTTGACTTTAGATTTGTCATACAATGAATTCGAAGGCGGTGTTCCACCTGCATTGGGAAATTGCAGTAGCCTTGACGCTTTAGTCATTGTGAGTGGTAACTTGTCAGGTACAATCCCTTCCTCATTGGGTATGTTGAAGAATCTCACAATTCTTAACCTTTCCGAGAATCGTCTCTCTGGGAGTATCCCCGCAGAGCTCGGGAACTGCAGTAGCTTGAACTTGTTGAAGCTGAACGATAACCAGCTTGTAGGCGGAATACCGAGTGCATTAGGTAAGCTGAGGAAGCTAGAAAGTCTGGAGCTTTTCGAAAACCGGTTTTCGGGTGAGATTCCTATTGAGATATGGAAGAGTCAGAGTCTTACGCAGTTGCTAGTTTATCAAAACAATCTCACTGGTGAACTACCTGTGGAAATGACTGAGATGAAGAAGCTAAAGATCGCTACGCTGTTCAACAACAGCTTTTATGGAGCGATACCACCGGGTTTAGGTGTGAACAGCAGCTTAGAAGAGGTTGACTTTATTGGTAACAAACTTACAGGAGAGATACCGCCAAATCTATGCCATGGAAGGAAGTTGAGAATACTCAACTTGGGTTCTAATCTGCTTCATGGTACAATACCAGCTTCTATTGGTCACTGTAAGACCATCAGGAGATTCATCCTTAGAGAAAATAACCTTTCAGGTCTTCTTCCTGAGTTTTCTCAGGATCATAGTCTTTCTTTTCTTGATTTCAATAGCAACAACTTCGAAGGACCAATCCCGGGCAGCCTCGGAAGCTGTAAGAATCTCTCGAGTATTAACCTATCTCGAAACAGATTCACGGGGCAGATACCTCCACAACTTGGGAATCTACAAAACCTTGGTTACATGAATCTTTCTCGTAATCTTCTTGAAGGGTCTCTACCAGCTCAGCTATCTAACTGTGTGAGTTTAGAGCGTTTTGATGTTGGCTTCAACTCATTAAACGGTTCAGTTCCTTCAAACTTTAGTAACTGGAAAGGCTTGACGACTTTAGTTCTCAGCGAGAACCGGTTTTCAGGAGGTATTCCACAGTTCTTGCCTGAGCTTAAGAAGCTGTCAACTCTGCAGATTGCTAGAAATGCTTTTGGTGGTGAGATTCCTTCGTCGATTGGGTTGATAGAGGATCTGATCTATGACTTGGACCTTAGTGGAAACGGATTGACAGGTGAAATTCCAGCCAAGTTGGGAGATCTCATCAAGTTAACAAGACTCAACATATCTAACAACAATTTGACAGGATCTTTATCGGTTCTCAAAGGTCTTACCTCATTGCTACATGTTGATGTCTCCAACAATCAGTTCACAGGTCCAATACCAGATAACTTGGAGGGTCAGTTGTTATCTGAGCCGTCGTCGTTTTCAGGAAATCCAAACCTCTGCATTCCACATTCCTTCTCTGCTAGCAACAATAGCCGCAGCGCGTTAAAGTACTGTAAAGATCAATCTAAAAGCAGGAAGAGTGGCCTTAGCACCTGGCAAATCGTGCTAATAGCGGTCTTATCGTCTTTATTAGTCTTGGTTGTGGTCCTTGCTCTTGTTTTCATTTGCCTACGTCGTCGCAAAGGAAGACCAGAGAAAGATGCTTATGTCTTCACTCAGGAGGAAGGCCCATCTTTGTTGTTGAACAAAGTTCTTGCAGCAACTGACAATCTAAATGAAAAGTACACCATTGGAAGAGGAGCTCATGGAATTGTGTACAGAGCTTCTTTAGGCTCCGGAAAGGTCTACGCTGTGAAGAGACTTGTATTCGCGTCTCACATCCGCGCTAACCAGAGTATGATGAGGGAGATTGATACAATCGGTAAAGTCAGGCACAGGAATCTGATTAAGTTAGAAGGGTTTTGGCTGAGGAAAGACGACGGTTTAATGCTGTATAGATACATGCCAAAAGGAAGTCTTTACGACGTTCTCCACGGTGTTAGCCCGAAAGAAAATGTGCTAGACTGGTCTGCACGGTACAATGTAGCACTTGGTGTCGCTCATGGACTAGCCTATCTACACTATGACTGCCATCCCCCGATTGTTCACCGTGACATCAAACCAGAGAACATACTCATGGACTCAGATTTGGAGCCTCACATTGGGGATTTCGGTTTGGCTCGCCTTCTTGATGACTCAACGGTTTCAACTGCAACTGTTACAGGCACCACCGGCTACATTGCACCAGAAAACGCTTTCAAAACCGTGAGGGGAAGAGAATCAGACGTTTACAGTTATGGAGTCGTGTTACTTGAGCTGGTTACGAGGAAGAGAGCGGTGGACAAATCTTTCCCGGAAAGTACAGATATAGTAAGCTGGGTGAGATCTGCCTTGAGCAGCAGCAACAACAATGTGGAGGATATGGTAACAACAATCGTCGATCCGATTCTCGTGGACGAGCTTCTGGATTCGAGTCTTAGGGAGCAGGTGATGCAAGTGACGGAACTGGCACTGAGTTGTACACAGCAAGATCCGGCAATGAGACCAACGATGAGAGATGCGGTGAAACTGTTGGAAGATGTGAAACATCTGGCAAGAAGCTGCTCCTCTGATTCAGTTCGGTAA


Protein sequences

Name Description Sequence
PEPR1 (PEP1 RECEPTOR 1); ATP binding / kinase/ protein binding / protein serine/threonine kinase PEPR1 (PEP1 RECEPTOR 1); ATP binding / kinase/ protein binding / protein serine/threonine kinase [Arabidopsis thaliana].

MKNLGGLFKILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHCKTIRRFILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEGQLLSEPSSFSGNPNLCIPHSFSASNNSRSALKYCKDQSKSRKSGLSTWQIVLIAVLSSLLVLVVVLALVFICLRRRKGRPEKDAYVFTQEEGPSLLLNKVLAATDNLNEKYTIGRGAHGIVYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLLEDVKHLARSCSSDSVR

Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-28 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MKNLGGLFKILLLFFCLFLSTHIISVSC

HMMPanther: PTHR24420
7-1115 PTHR24420,FAMILY NOT NAMED

LFKILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHCKTIRRFILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEGQLLSEPSSFSGNPNLCIPHSFSASNNSRSALKYCKDQSKSRKSGLSTWQIVLIAVLSSLLVLVVVLALVFICLRRRKGRPEKDAYVFTQEEGPSLLLNKVLAATDNLNEKYTIGRGAHGIVYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLLEDVKHLAR

HMMPanther: PTHR24420:SF471
7-1115 PTHR24420:SF471,SUBFAMILY NOT NAMED

LFKILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHCKTIRRFILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEGQLLSEPSSFSGNPNLCIPHSFSASNNSRSALKYCKDQSKSRKSGLSTWQIVLIAVLSSLLVLVVVLALVFICLRRRKGRPEKDAYVFTQEEGPSLLLNKVLAATDNLNEKYTIGRGAHGIVYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLLEDVKHLAR

Gene3D: G3DSA:3.80.10.10
28-292 G3DSA:3.80.10.10

CLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSS

HMMPfam: PF08263
IPR013210
29-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

LNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCD

superfamily: SSF52047
79-400 SSF52047,LRR

SLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLT

HMMPfam: PF12799
99-139 LRR_4,Leucine Rich repeats (2 copies)

KSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKI

ProfileScan: PS51450
IPR001611
100-123 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQILDLSTNNFSGTIPSTLGNCT

ProfileScan: PS51450
IPR001611
124-147 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLATLDLSENGFSDKIPDTLDSLK

ProfileScan: PS51450
IPR001611
148-170 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLEVLYLYINFLTGELPESLFRI

ProfileScan: PS51450
IPR001611
172-194 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLYLDYNNLTGPIPQSIGDA

HMMPfam: PF00560
IPR001611
172-191 LRR_1
Leucine-rich repeat

KLQVLYLDYNNLTGPIPQSI

ProfileScan: PS51450
IPR001611
220-242 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQILYLHRNKLVGSLPESLNLL

ProfileScan: PS51450
IPR001611
268-290 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLLTLDLSYNEFEGGVPPALGNC

Gene3D: G3DSA:3.80.10.10
293-501 G3DSA:3.80.10.10

LDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHCKTIRRFILRENNLSGLLPE

HMMPfam: PF00560
IPR001611
316-338 LRR_1
Leucine-rich repeat

NLTILNLSENRLSGSIPAELGNC

ProfileScan: PS51450
IPR001611
316-338 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTILNLSENRLSGSIPAELGNC

ProfileScan: PS51450
IPR001611
364-385 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLESLELFENRFSGEIPIEIWK

superfamily: SSF52047
402-759 SSF52047,LRR

ELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHCKTIRRFILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEGQLLSEPSSFSGNPNLCIPHSFSASNNSRSALKYCKDQSK

ProfileScan: PS51450
IPR001611
436-458 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEEVDFIGNKLTGEIPPNLCHG

ProfileScan: PS51450
IPR001611
460-482 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRILNLGSNLLHGTIPASIGHC

Gene3D: G3DSA:3.80.10.10
502-728 G3DSA:3.80.10.10

FSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKGLTSLLHVDVSNNQFTGPIPDNLEGQLLSEPSS

ProfileScan: PS51450
IPR001611
531-554 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSSINLSRNRFTGQIPPQLGNLQ

HMMPfam: PF00560
IPR001611
531-553 LRR_1
Leucine-rich repeat

NLSSINLSRNRFTGQIPPQLGNL

ProfileScan: PS51450
IPR001611
555-578 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLGYMNLSRNLLEGSLPAQLSNCV

ProfileScan: PS51450
IPR001611
603-626 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTTLVLSENRFSGGIPQFLPELK

ProfileScan: PS51450
IPR001611
676-698 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTRLNISNNNLTGSLSVLKGLT

HMMPfam: PF00560
IPR001611
676-697 LRR_1
Leucine-rich repeat

KLTRLNISNNNLTGSLSVLKGL

Gene3D: G3DSA:2.60.120.200
IPR013320
746-845 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

NSRSALKYCKDQSKSRKSGLSTWQIVLIAVLSSLLVLVVVLALVFICLRRRKGRPEKDAYVFTQEEGPSLLLNKVLAATDNLNEKYTIGRGAHGIVYRAS

superfamily: SSF56112
IPR011009
797-1115 Kinase_like
Protein kinase-like domain

KGRPEKDAYVFTQEEGPSLLLNKVLAATDNLNEKYTIGRGAHGIVYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLLEDVKHLAR

ProfileScan: PS50011
IPR000719
827-1115 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LNEKYTIGRGAHGIVYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLLEDVKHLAR

HMMPfam: PF00069
IPR000719
831-1105 Pkinase,Ser-thr
Protein kinase, catalytic domain

YTIGRGAHGIVYRASLGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMPKGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVK

PatternScan: PS00107
IPR017441
833-855 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGAHGIVYRASLGSGKVYAVK

Gene3D: G3DSA:3.30.200.20
846-905 G3DSA:3.30.200.20

LGSGKVYAVKRLVFASHIRANQSMMREIDTIGKVRHRNLIKLEGFWLRKDDGLMLYRYMP

Gene3D: G3DSA:1.10.510.10
906-1107 G3DSA:1.10.510.10

KGSLYDVLHGVSPKENVLDWSARYNVALGVAHGLAYLHYDCHPPIVHRDIKPENILMDSDLEPHIGDFGLARLLDDSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLL

PatternScan: PS00108
IPR008271
950-962 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPENILM


Diseases

Disease Pathogen Avirulence gene
Damping Off Pythium




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox