PRGDB00035721 (ER - Erecta)

From PRG Wiki
Jump to: navigation, search
ER - Erecta
Gene Type Reference_R-Genes,_manually_curated
GenBank 30683082 (NM_128190)
Gene Class RLK
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 2
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ER (ERECTA) (ER) mRNA, complete cds.

DNA Sequence

ATGGCTCTGTTTAGAGATATTGTTCTTCTTGGGTTTCTCTTCTGCTTGAGCTTAGTAGCTACTGTGACTTCAGAGGAGGGAGCAACGTTGCTGGAGATTAAGAAGTCATTCAAAGATGTGAACAATGTTCTTTATGACTGGACAACTTCACCTTCTTCGGATTATTGTGTCTGGAGAGGTGTGTCTTGTGAAAATGTCACCTTCAATGTTGTTGCTCTTAATTTGTCAGATTTGAATCTTGATGGAGAAATCTCACCTGCTATTGGAGATCTCAAGAGTCTCTTGTCAATTGATCTGCGAGGTAATCGCTTGTCTGGACAAATCCCTGATGAGATTGGTGACTGTTCTTCTTTGCAAAACTTAGACTTATCCTTCAATGAATTAAGTGGTGACATACCGTTTTCGATTTCGAAGTTGAAGCAACTTGAGCAGCTGATTCTGAAGAATAACCAATTGATAGGACCGATCCCTTCAACACTTTCACAGATTCCAAACCTGAAAATTCTGGACTTGGCACAGAATAAACTCAGTGGTGAGATACCAAGACTTATTTACTGGAATGAAGTTCTTCAGTATCTTGGGTTGCGAGGAAACAACTTAGTCGGTAACATTTCTCCAGATTTGTGTCAACTGACTGGTCTTTGGTATTTTGACGTAAGAAACAACAGTTTGACTGGTAGTATACCTGAGACGATAGGAAATTGCACTGCCTTCCAGGTTTTGGACTTGTCCTACAATCAGCTAACTGGTGAGATCCCTTTTGACATCGGCTTCCTGCAAGTTGCAACATTATCATTGCAAGGCAATCAACTCTCTGGGAAGATTCCATCAGTGATTGGTCTCATGCAAGCCCTTGCAGTCTTAGATCTAAGTGGCAACTTGTTGAGTGGATCTATTCCTCCGATTCTCGGAAATCTTACTTTCACCGAGAAATTGTATTTGCACAGTAACAAGCTGACTGGTTCAATTCCACCTGAGCTTGGAAACATGTCAAAACTCCATTACCTGGAACTCAATGATAATCATCTCACGGGTCATATACCACCAGAGCTTGGGAAGCTTACTGACTTGTTTGATCTGAATGTGGCCAACAATGATCTGGAAGGACCTATACCTGATCATCTGAGCTCTTGCACAAATCTAAACAGCTTAAATGTTCATGGGAACAAGTTTAGTGGCACTATACCCCGAGCATTTCAAAAGCTAGAAAGTATGACTTACCTTAATCTGTCCAGCAACAATATCAAAGGTCCAATCCCGGTTGAGCTATCTCGTATCGGTAACTTAGATACATTGGATCTTTCCAACAACAAGATAAATGGAATCATTCCTTCTTCCCTTGGTGATTTGGAGCATCTTCTCAAGATGAACTTGAGTAGAAATCATATAACTGGTGTAGTTCCAGGCGACTTTGGAAATCTAAGAAGCATCATGGAAATAGATCTTTCAAATAATGATATCTCTGGCCCAATTCCAGAAGAGCTTAACCAATTACAGAACATAATTTTGCTGAGACTGGAAAATAATAACCTGACTGGTAATGTTGGTTCATTAGCCAACTGTCTCAGTCTCACTGTATTGAATGTATCTCATAACAACCTCGTAGGTGATATCCCTAAGAACAATAACTTCTCAAGATTTTCACCAGACAGCTTCATTGGCAATCCTGGTCTTTGCGGTAGTTGGCTAAACTCACCGTGTCATGATTCTCGTCGAACTGTACGAGTGTCAATCTCTAGAGCAGCTATTCTTGGAATAGCTATTGGGGGACTTGTGATCCTTCTCATGGTCTTAATAGCAGCTTGCCGACCGCATAATCCTCCTCCTTTTCTTGATGGATCACTTGACAAACCAGTAACTTATTCGACACCGAAGCTCGTCATCCTTCATATGAACATGGCACTCCACGTTTACGAGGATATCATGAGAATGACAGAGAATCTAAGTGAGAAGTATATCATTGGGCACGGAGCATCAAGCACTGTATACAAATGTGTTTTGAAGAATTGTAAACCGGTTGCGATTAAGCGGCTTTACTCTCACAACCCACAGTCAATGAAACAGTTTGAAACAGAACTCGAGATGCTAAGTAGCATCAAGCACAGAAATCTTGTGAGCCTACAAGCTTATTCCCTCTCTCACTTGGGGAGTCTTCTGTTCTATGACTATTTGGAAAATGGTAGCCTCTGGGATCTTCTTCATGGCCCTACGAAGAAAAAGACTCTTGATTGGGACACACGGCTTAAGATAGCATATGGTGCAGCACAAGGTTTAGCTTATCTACACCATGACTGTAGTCCAAGGATCATTCACAGAGACGTGAAGTCGTCCAACATTCTCTTGGACAAAGACTTAGAGGCTCGTTTGACAGATTTTGGAATAGCGAAAAGCTTGTGTGTGTCAAAGTCACATACTTCAACTTACGTGATGGGCACGATAGGTTACATAGACCCCGAGTATGCTCGCACTTCACGGCTCACTGAGAAATCCGATGTCTACAGTTATGGAATAGTCCTTCTTGAGTTGTTAACCCGAAGGAAAGCCGTTGATGACGAATCCAATCTCCACCATCTGATAATGTCAAAGACGGGGAACAATGAAGTGATGGAAATGGCAGATCCAGACATCACATCGACGTGTAAAGATCTCGGTGTGGTGAAGAAAGTTTTCCAACTGGCACTCCTATGCACCAAAAGACAGCCGAATGATCGACCCACAATGCACCAGGTGACTCGTGTTCTCGGCAGTTTTATGCTATCGGAACAACCACCTGCTGCGACTGACACGTCAGCGACGCTGGCTGGTTCGTGCTACGTCGATGAGTATGCAAATCTCAAGACTCCTCATTCTGTCAATTGCTCTTCCATGAGTGCTTCTGATGCTCAACTGTTTCTTCGGTTTGGACAAGTTATTTCTCAGAACAGTGAGTAG


Protein sequences

Name Description Sequence
ER (ERECTA) ER (ERECTA) [Arabidopsis thaliana].

MALFRDIVLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRTVRVSISRAAILGIAIGGLVILLMVLIAACRPHNPPPFLDGSLDKPVTYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSATLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNSE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
7-924 PTHR24420,FAMILY NOT NAMED

IVLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRTVRVSISRAAILGIAIGGLVILLMVLIAACRPHNPPPFLDGSLDKPVTYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPP

HMMPanther: PTHR24420:SF825
7-924 PTHR24420:SF825

IVLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRTVRVSISRAAILGIAIGGLVILLMVLIAACRPHNPPPFLDGSLDKPVTYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPP

superfamily: SSF52058
20-317 SSF52058,LRR

ATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSN

Gene3D: G3DSA:3.80.10.10
24-259 G3DSA:3.80.10.10

SEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFL

HMMPfam: PF08263
IPR013210
25-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSC

ProfileScan: PS51450
IPR001611
93-115 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLSIDLRGNRLSGQIPDEIGDC

HMMPfam: PF00560
IPR001611
93-114 LRR_1
Leucine-rich repeat

SLLSIDLRGNRLSGQIPDEIGD

HMMPfam: PF13516
115-136 LRR_6,Leucine Rich repeat

CSSLQNLDLSFNELSGDIPFSI

ProfileScan: PS51450
IPR001611
117-140 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQNLDLSFNELSGDIPFSISKLK

ProfileScan: PS51450
IPR001611
141-163 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEQLILKNNQLIGPIPSTLSQI

ProfileScan: PS51450
IPR001611
165-187 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKILDLAQNKLSGEIPRLIYWN

ProfileScan: PS51450
IPR001611
189-212 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLQYLGLRGNNLVGNISPDLCQLT

ProfileScan: PS51450
IPR001611
237-259 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

AFQVLDLSYNQLTGEIPFDIGFL

HMMPfam: PF00560
IPR001611
239-257 LRR_1
Leucine-rich repeat

QVLDLSYNQLTGEIPFDIG

superfamily: SSF52058
250-555 SSF52058,LRR

GEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGN

ProfileScan: PS51450
IPR001611
260-282 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QVATLSLQGNQLSGKIPSVIGLM

ProfileScan: PS51450
IPR001611
284-306 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALAVLDLSGNLLSGSIPPILGNL

HMMPfam: PF00560
IPR001611
285-306 LRR_1
Leucine-rich repeat

LAVLDLSGNLLSGSIPPILGNL

Gene3D: G3DSA:3.80.10.10
288-547 G3DSA:3.80.10.10

LDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRF

ProfileScan: PS51450
IPR001611
308-330 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FTEKLYLHSNKLTGSIPPELGNM

ProfileScan: PS51450
IPR001611
332-355 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLHYLELNDNHLTGHIPPELGKLT

HMMPfam: PF00560
IPR001611
332-354 LRR_1
Leucine-rich repeat

KLHYLELNDNHLTGHIPPELGKL

HMMPfam: PF13855
359-415 LRR_8,Leucine rich repeat

DLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNI

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLNSLNVHGNKFSGTIPRAFQK

ProfileScan: PS51450
IPR001611
404-425 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SMTYLNLSSNNIKGPIPVELSR

ProfileScan: PS51450
IPR001611
428-449 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLDTLDLSNNKINGIIPSSLGD

HMMPfam: PF13855
428-487 LRR_8,Leucine rich repeat

NLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDI

ProfileScan: PS51450
IPR001611
452-473 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLLKMNLSRNHITGVVPGDFGN

ProfileScan: PS51450
IPR001611
476-498 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIMEIDLSNNDISGPIPEELNQL

ProfileScan: PS51450
IPR001611
500-522 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIILLRLENNNLTGNVGSLANCL

ProfileScan: PS51450
IPR001611
523-545 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTVLNVSHNNLVGDIPKNNNFS

HMMPfam: PF00560
IPR001611
523-541 LRR_1
Leucine-rich repeat

SLTVLNVSHNNLVGDIPKN

superfamily: SSF56112
IPR011009
620-914 Kinase_like
Protein kinase-like domain

TYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL

Gene3D: G3DSA:3.30.200.20
632-698 G3DSA:3.30.200.20

NMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSS

ProfileScan: PS50011
IPR000719
648-918 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFM

HMMPfam: PF00069
IPR000719
652-911 Pkinase,Ser-thr
Protein kinase, catalytic domain

YIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVT

PatternScan: PS00107
IPR017441
654-676 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGASSTVYKCVLKNCKPVAIK

Gene3D: G3DSA:1.10.510.10
699-912 G3DSA:1.10.510.10

IKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTR

PatternScan: PS00108
IPR008271
769-781 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSSNILL


Diseases

Disease Pathogen Avirulence gene
Bacterial Wilt (Arabidopsis) Ralstonia solanacearum




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox