PRGDB00035722 (PGIP)

From PRG Wiki
Jump to: navigation, search
PGIP
Gene Type Reference_R-Genes,_manually_curated
GenBank 21028 (X64769)
Gene Class RLP
Domain Type LRR, LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Phaseolus vulgaris

Comment?

P.vulgaris pgip gene for polygalacturonase-inhibiting protein.

DNA Sequence

ATGACTCAATTCAATATCCCAGTAACCATGTCTTCAAGCTTAAGCATAATTTTGGTCATTCTTGTATCTTTGAGAACTGCACTCTCAGAGCTATGCAACCCACAAGATAAGCAAGCCCTTCTCCAAATCAAGAAAGACCTTGGCAACCCAACCACTCTCTCTTCATGGCTTCCAACCACCGACTGTTGTAACAGAACCTGGCTAGGTGTTTTATGCGACACCGACACCCAAACATATCGCGTCAACAACCTCGACCTCTCCGGCCATAACCTCCCAAAACCCTACCCTATCCCTTCCTCCCTCGCCAACCTCCCCTACCTCAATTTTCTATACATTGGCGGCATCAATAACCTCGTCGGTCCAATCCCCCCCGCCATCGCTAAACTCACCCAACTCCACTATCTCTATATCACTCACACCAATGTCTCCGGCGCAATACCCGATTTCTTGTCACAGATCAAAACCCTCGTCACCCTCGACTTCTCCTACAACGCCCTCTCCGGCACCCTCCCTCCCTCCATCTCTTCTCTCCCCAACCTCGGAGGAATCACATTCGACGGCAACCGAATCTCCGGCGCCATCCCCGACTCCTACGGCTCGTTTTCGAAGCTGTTTACGGCGATGACCATCTCCCGCAACCGCCTCACCGGGAAGATTCCACCGACGTTTGCGAATCTGAACCTGGCGTTCGTTGACTTGTCTCGGAACATGCTGGAGGGTGACGCGTCGGTGTTGTTCGGGTCAGATAAGAACACGAAGAAGATACATCTGGCGAAGAACTCTCTTGCTTTTGATTTGGGGAAAGTGGGGTTGTCAAAGAACTTGAACGGGTTGGATCTGAGGAACAACCGTATCTATGGGACGCTACCTCAGGGACTAACGCAGCTAAAGTTTCTGCAAAGTTTAAATGTGAGCTTCAACAATCTGTGCGGTGAGATTCCTCAAGGTGGGAACTTGAAAAGGTTTGACGTTTCTTCTTATGCCAACAACAAGTGCTTGTGTGGTTCTCCTCTTCCTTCCTGCACTTAA


Protein sequences

Name Description Sequence
polygalacturanase-inhibiting protein polygalacturanase-inhibiting protein [Phaseolus vulgaris].

MTQFNIPVTMSSSLSIILVILVSLRTALSELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSPLPSCT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
9-337 FAMILY NOT NAMED,FAMILY NOT NAMED

TMSSSLSIILVILVSLRTALSELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSP

Seg: seg
11-24 seg

SSSLSIILVILVSL

superfamily: SSF52058
30-342 L domain-like,LRR

ELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSPLPSCT

Gene3D: G3DSA:3.80.10.10
32-338 no description

CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSPL

HMMPfam: PF08263
IPR013210
34-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCD

HMMPfam: PF00560
IPR001611
156-177 LRR_1
Leucine-rich repeat

LVTLDFSYNALSGTLPPSISSL

HMMPfam: PF00560
IPR001611
299-315 LRR_1
Leucine-rich repeat

LQSLNVSFNNLCGEIPQ


Diseases

Disease Pathogen Avirulence gene
Eliciting Fungus Fungus producing polygalacturonases

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox