PRGDB00035722 (PGIP)

From PRG Wiki
Jump to: navigation, search
PGIP
Gene Type Reference_R-Genes,_manually_curated
GenBank 21028 (X64769)
Gene Class RLP
Domain Type LRR, LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Phaseolus vulgaris

Comment?

P.vulgaris pgip gene for polygalacturonase-inhibiting protein.

DNA Sequence

ATGACTCAATTCAATATCCCAGTAACCATGTCTTCAAGCTTAAGCATAATTTTGGTCATTCTTGTATCTTTGAGAACTGCACTCTCAGAGCTATGCAACCCACAAGATAAGCAAGCCCTTCTCCAAATCAAGAAAGACCTTGGCAACCCAACCACTCTCTCTTCATGGCTTCCAACCACCGACTGTTGTAACAGAACCTGGCTAGGTGTTTTATGCGACACCGACACCCAAACATATCGCGTCAACAACCTCGACCTCTCCGGCCATAACCTCCCAAAACCCTACCCTATCCCTTCCTCCCTCGCCAACCTCCCCTACCTCAATTTTCTATACATTGGCGGCATCAATAACCTCGTCGGTCCAATCCCCCCCGCCATCGCTAAACTCACCCAACTCCACTATCTCTATATCACTCACACCAATGTCTCCGGCGCAATACCCGATTTCTTGTCACAGATCAAAACCCTCGTCACCCTCGACTTCTCCTACAACGCCCTCTCCGGCACCCTCCCTCCCTCCATCTCTTCTCTCCCCAACCTCGGAGGAATCACATTCGACGGCAACCGAATCTCCGGCGCCATCCCCGACTCCTACGGCTCGTTTTCGAAGCTGTTTACGGCGATGACCATCTCCCGCAACCGCCTCACCGGGAAGATTCCACCGACGTTTGCGAATCTGAACCTGGCGTTCGTTGACTTGTCTCGGAACATGCTGGAGGGTGACGCGTCGGTGTTGTTCGGGTCAGATAAGAACACGAAGAAGATACATCTGGCGAAGAACTCTCTTGCTTTTGATTTGGGGAAAGTGGGGTTGTCAAAGAACTTGAACGGGTTGGATCTGAGGAACAACCGTATCTATGGGACGCTACCTCAGGGACTAACGCAGCTAAAGTTTCTGCAAAGTTTAAATGTGAGCTTCAACAATCTGTGCGGTGAGATTCCTCAAGGTGGGAACTTGAAAAGGTTTGACGTTTCTTCTTATGCCAACAACAAGTGCTTGTGTGGTTCTCCTCTTCCTTCCTGCACTTAA


Protein sequences

Name Description Sequence
polygalacturanase-inhibiting protein polygalacturanase-inhibiting protein [Phaseolus vulgaris].

MTQFNIPVTMSSSLSIILVILVSLRTALSELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSPLPSCT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
9-337 FAMILY NOT NAMED,FAMILY NOT NAMED

TMSSSLSIILVILVSLRTALSELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSP

Seg: seg
11-24 seg

SSSLSIILVILVSL

superfamily: SSF52058
30-342 L domain-like,LRR

ELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSPLPSCT

Gene3D: G3DSA:3.80.10.10
32-338 no description

CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGHNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLQSLNVSFNNLCGEIPQGGNLKRFDVSSYANNKCLCGSPL

HMMPfam: PF08263
IPR013210
34-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCD

HMMPfam: PF00560
IPR001611
156-177 LRR_1
Leucine-rich repeat

LVTLDFSYNALSGTLPPSISSL

HMMPfam: PF00560
IPR001611
299-315 LRR_1
Leucine-rich repeat

LQSLNVSFNNLCGEIPQ


Diseases

Disease Pathogen Avirulence gene
Eliciting Fungus Fungus producing polygalacturonases

List of References

P Toubart, A Desiderio, G Salvi, F Cervone, L Daroda, G De Lorenzo
Cloning and characterization of the gene encoding the endopolygalacturonase-inhibiting protein (PGIP) of Phaseolus vulgaris L.
Plant J.: 1992, 2(3);367-73
PubMed:1303801 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox