PRGDB00035724 (P2)

From PRG Wiki
Jump to: navigation, search
P2
Gene Type Reference_R-Genes,_manually_curated
GenBank 13517467 (AF310960)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Linum usitatissimum

Comment?

Linum usitatissimum cv. 'Abyssinian' resistance-like protein P2-A (p2-A), P2 rust resistance protein, and germin-like protein genes, complete cds.

DNA Sequence

ATGGCTTTTTCTTCTGCTTCTTCTTCTTCTTCACCTCAGAGTTCTCTGTATACTGGAGAATGGGAGTACGATGTTTTCTTGTGTTTTAGAGGCGATGACACACGCGATGGTTTCACCAGCCACCTCCTGTCTGCTTTATCAGACAAAAAAATCAGAGCCTTCATCGACGAGAAGCTCGAAAAAACTGAAAGCATCGACGAGCTAATCTCGATCCTCCAGAGATGTCCTCTTTCTGTGGTGGTTTTCTCCGAGAGATTTGCGGATTCTATCTGGTGCTTGGAAGAGGTGGTTACTATCGCTGAAAGGATGGAGAAAGTTGGACACCGGGTTCTTCCGGTTTTCTATAAAGTGGATCCGTCCGATGTGAAAGATAAATCACATCGAACGGGTCCAAAGAGATGGATGGATGCTTTGAAAGCTGTGGCTAAGTGTGCTGGTCATACTTCGCAGGCCATCAAAATTGAATCGGAATTGATTAAGGCGGTTGTGGAAACTGTTCAGAAGCAACTAATCGACATGTCACCGAGTATCAATCGTAATAACTTGGTTGCTATGGGTTCACGTATTTTCGAGGTTGAGCGACTATTAGCTATGGACAAACTAGATGATACTTGCATCATTGGGCTATGGGAAATGGGCGGTGTTGGGAAAACAACTCTAGCCGAAGCGTGTTATGACAGGGTAACTTCGTCCAACAAAGGAATCAAACATCTTTTCGTTCGAAACGTGAATGAAATATGTGAAAAGCATCATGGCGTTGAAAAAATTGTTCACAAACTCTATTCAAAATTGTTGGACGAGAATAACATCGACCGTGAAGATTTGAATATTGGTTATCGAAGGGAACGTCTTTCGCGCTCGAGGGTATTCGTTGTTCTAGACAACGTTGAAACTTTGGAGCAATTGGCTTTAGGATATGTGTTCAATCTCAGCAAAGTCTTTGCAGCGGGGAGTAGGATCATCATCACCACAAGAAATAAAAAGGTGCTTCAAAATGCTATGGCCAAGATTTACAATGTCGAGTGTTTGAATGACGAGGAATCTACCCGGTTGTTTAGCTTACATGCATTCAAACAAGATCGACCTCAAGATAATTGGATGGGTAAGTCACGTCTCGCAACATCATATTGTAAGGGAAATCCTTTGGCACTCAAAATCTTGGGGGGTGCATTGTACGGTGAAGATATACATTATTGGAGAAGTTTCTTGACCGGTTTGAGGCAACCTGGAAACCTAGGTATTGAGAATATTCTGAGGAGAAGTTATGATAAACTTGGGAAGGAAGAGAAGAAAATATTTATGGATGTTGCCTGTCTACTCTATGGCATGTCAAGATCTAGACTGATTGATTATATGGCGACTATGTATTCCTCTTCTTATGTCAGGGTGAAGGATTTAATTGACAAATCCCTATTAACTTGTGTTTCTAGCAAGAATGAAGACAAGATTGAGGTGCATGATTTGCTTAAAGAAATGGCTTGGAACATTGTCAAAGAAGAACCAAAGCTTGGCAAACGAAGCAGATTAGTAGATCCGGATGATGTCCATAAATTATTGTCAACTTCAGAGGTTAAAAATTGGAGTACATCAATCGTCAACCTCTTCAAAGGCATAGTGATGGTCATACCAAGAAGGAAAAGAAGAAAAGTCACTGACATGCATGAGAAAGGCTATGATCCATTGGAGGAACATCGAACAACTGAAGGTATATGTTTGGATCTCTCTGGAACTAAAGAGATGTGTTTGAAAGCAAATGCCTTTGAGGGTATGAATTCTCTTACATTTCTCAAATTCGAGTCGCCAGAAATTAAGTATCCTCATTATCCTTTAAAAAATGTGAAGACGAAAATTCATTTGCCTTACTATGGACTTAACTCCCTTCCGGAGGGGTTAAGATGGTTGCAGTGGGATGGATATCCTTCAAAATCTCTACCGGCAAAGTTTTATCCCCAACACCTTGTTCATCTCATTATACGTGGAAGTCCAATTCGAAGATGTTGGGAAGGATATGATCAACCCCAACTTGTGAACTTGATTGTGCTTGATCTCCGCTACTGTGCAAATCTAATCGCTATTCCGGATATATCAAGTTCTTTGAATCTCGAAGAACTCCTTCTTTGTCGATGCGTAAGCCTAGTTGAGGTACCATTTCATGTTCAATATTTGACCAAGCTGGTAACGCTAGACATCAATTATTGCAAAAATCTCAAGCGTCTTCCACCTAAACTTGACTCAAAGTTACTTAAGCACGTTCGGATGAAAAATCTCGAGGTCACATGCTGTCCAGAGATTGATTCGAGAGAGTTGGAGGAATTTGATTTAAGTGGTACATCTCTCGGAGAGTTACCCAGTGCAATTTACAATGTCAAGCAAAATGGAGTCCTACGTCTCCATGGCAAAAACATTACCAAATTTCCTGGAATTACAACAATATTGAAGCGTTTTAAATTAAGTTTAAGCGGTACTTCAATAAGGGAGATTGATTTGGCCGATTATCATCAACAGCATCAGACTTCTGATGGATTACTATTGCCAAAATTTCATAATTTGTCGTTGACAGGCAACCGGCAACTTGAGGTCCTGCCAAACAGTATATGGAACATGATTTCTGAAGAACTTTTTATTTGTTCGAGCCCGCTGATTGAAAGTTTGCCGGAAATCTCAGAGCCTATGAGTACCTTAACTTCTCTTCATGTATTCTGTTGTAGAAGCCTCACAAGTATTCCAACTAGCATCAGCAATTTAAGATCTCTGATATCGCTTTGTTTAGTAGAGACGGGTATTAAGTCTCTGCCTTCTAGCATCCAAGAACTAAGGCAGCTTTTTTCGATTGATCTTAGAGATTGCAAAAGCCTCGAGTCAATTCCAAACAGTATCCATAAGCTTTCCAAGTTGGTAACTTTGTCAATGTCTGGCTGTGAGATCATTATATCTTTGCCTGAACTCCCACCAAATCTGAAGACCTTGAACGTAAGTGGTTGCAAGTCTTTACAAGCTCTACCAAGCAACACATGTAAGCTGTTGTACCTGAATACGATCCATTTTGACGGATGTCCACAATTGGACCAGGCTATACCTGGCGAGTTCGTGGCAAATTTCCTCGTTCATGCCAGCTTGTCTCCGTCATATGAGCGGCAAGTTAGATGTTCAGGAAGCGAGCTTCCGAAATGGTTTTCGTACAGAAGCATGGAGGACGAGGATTGCAGTACTGTGAAAGTGGAGTTGCCTCTTGCTAATGATAGTCCTGACCATCCAATGATTAAGGGAATTGCATTCGGCTGTGTGTATTCTTGCGACTCCTACTATTGGATGAATATGGGATGTCGTTGCGAGGTCGGTAACACCACTGTTGCATCTTGGGTTTCCACCGAAATACTAATGGGCCATGAAGAAAACTCATCAGAAAAGGTATGGTTGGTGTTCCACAAGAATTTATCAGGTACGGAGTCTATGGGAAGCGAAGAAGATGAAGCGTGGTATGTGAAGTATGGCGGGTTTGCTGTCTCATTCAATTTCTACTTAGTAGATTTCTACGGTGAAATCATGAAGGAGGTGAAAATAAAAAGATTTGGAGTCTCTCTGATGTATTAA


Protein sequences

Name Description Sequence
resistance-like protein P2-A resistance-like protein P2-A [Linum usitatissimum].

MAFSSASSSSSPQSSLYTGEWEYDVFLCFRGDDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHRTGPKRWMDALKAVAKCAGHTSQAIKIESELIKAVVETVQKQLIDMSPSINRNNLVAMGSRIFEVERLLAMDKLDDTCIIGLWEMGGVGKTTLAEACYDRVTSSNKGIKHLFVRNVNEICEKHHGVEKIVHKLYSKLLDENNIDREDLNIGYRRERLSRSRVFVVLDNVETLEQLALGYVFNLSKVFAAGSRIIITTRNKKVLQNAMAKIYNVECLNDEESTRLFSLHAFKQDRPQDNWMGKSRLATSYCKGNPLALKILGGALYGEDIHYWRSFLTGLRQPGNLGIENILRRSYDKLGKEEKKIFMDVACLLYGMSRSRLIDYMATMYSSSYVRVKDLIDKSLLTCVSSKNEDKIEVHDLLKEMAWNIVKEEPKLGKRSRLVDPDDVHKLLSTSEVKNWSTSIVNLFKGIVMVIPRRKRRKVTDMHEKGYDPLEEHRTTEGICLDLSGTKEMCLKANAFEGMNSLTFLKFESPEIKYPHYPLKNVKTKIHLPYYGLNSLPEGLRWLQWDGYPSKSLPAKFYPQHLVHLIIRGSPIRRCWEGYDQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSLVEVPFHVQYLTKLVTLDINYCKNLKRLPPKLDSKLLKHVRMKNLEVTCCPEIDSRELEEFDLSGTSLGELPSAIYNVKQNGVLRLHGKNITKFPGITTILKRFKLSLSGTSIREIDLADYHQQHQTSDGLLLPKFHNLSLTGNRQLEVLPNSIWNMISEELFICSSPLIESLPEISEPMSTLTSLHVFCCRSLTSIPTSISNLRSLISLCLVETGIKSLPSSIQELRQLFSIDLRDCKSLESIPNSIHKLSKLVTLSMSGCEIIISLPELPPNLKTLNVSGCKSLQALPSNTCKLLYLNTIHFDGCPQLDQAIPGEFVANFLVHASLSPSYERQVRCSGSELPKWFSYRSMEDEDCSTVKVELPLANDSPDHPMIKGIAFGCVYSCDSYYWMNMGCRCEVGNTTVASWVSTEILMGHEENSSEKVWLVFHKNLSGTESMGSEEDEAWYVKYGGFAVSFNFYLVDFYGEIMKEVKIKRFGVSLMY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
11-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SPQSSLYTGEWEYDVFLCFRGDDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHRTGPKRWMDALKAVAKCAGH

Gene3D: G3DSA:3.40.50.10140
20-128 G3DSA:3.40.50.10140

EWEYDVFLCFRGDDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHR

ProfileScan: PS50104
IPR000157
21-126 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WEYDVFLCFRGDDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKS

HMMSmart: SM00255
IPR000157
22-169 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EYDVFLCFRGDDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHRTGPKRWMDALKAVAKCAGHTSQAIKIESELIKAVVETVQKQ

HMMPfam: PF01582
IPR000157
25-129 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLCFRGDDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHRT

HMMPanther: PTHR11017:SF20
32-1063 PTHR11017:SF20,SUBFAMILY NOT NAMED

DDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHRTGPKRWMDALKAVAKCAGHTSQAIKIESELIKAVVETVQKQLIDMSPSINRNNLVAMGSRIFEVERLLAMDKLDDTCIIGLWEMGGVGKTTLAEACYDRVTSSNKGIKHLFVRNVNEICEKHHGVEKIVHKLYSKLLDENNIDREDLNIGYRRERLSRSRVFVVLDNVETLEQLALGYVFNLSKVFAAGSRIIITTRNKKVLQNAMAKIYNVECLNDEESTRLFSLHAFKQDRPQDNWMGKSRLATSYCKGNPLALKILGGALYGEDIHYWRSFLTGLRQPGNLGIENILRRSYDKLGKEEKKIFMDVACLLYGMSRSRLIDYMATMYSSSYVRVKDLIDKSLLTCVSSKNEDKIEVHDLLKEMAWNIVKEEPKLGKRSRLVDPDDVHKLLSTSEVKNWSTSIVNLFKGIVMVIPRRKRRKVTDMHEKGYDPLEEHRTTEGICLDLSGTKEMCLKANAFEGMNSLTFLKFESPEIKYPHYPLKNVKTKIHLPYYGLNSLPEGLRWLQWDGYPSKSLPAKFYPQHLVHLIIRGSPIRRCWEGYDQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSLVEVPFHVQYLTKLVTLDINYCKNLKRLPPKLDSKLLKHVRMKNLEVTCCPEIDSRELEEFDLSGTSLGELPSAIYNVKQNGVLRLHGKNITKFPGITTILKRFKLSLSGTSIREIDLADYHQQHQTSDGLLLPKFHNLSLTGNRQLEVLPNSIWNMISEELFICSSPLIESLPEISEPMSTLTSLHVFCCRSLTSIPTSISNLRSLISLCLVETGIKSLPSSIQELRQLFSIDLRDCKSLESIPNSIHKLSKLVTLSMSGCEIIISLPELPPNLKTLNVSGCKSLQALPSNTCKLLYLNTIHFDGCPQLDQAIPGEFVANFLVHASLSPSYERQVRCSGSELPKWFSYRSM

HMMPanther: PTHR11017
32-1063 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DDTRDGFTSHLLSALSDKKIRAFIDEKLEKTESIDELISILQRCPLSVVVFSERFADSIWCLEEVVTIAERMEKVGHRVLPVFYKVDPSDVKDKSHRTGPKRWMDALKAVAKCAGHTSQAIKIESELIKAVVETVQKQLIDMSPSINRNNLVAMGSRIFEVERLLAMDKLDDTCIIGLWEMGGVGKTTLAEACYDRVTSSNKGIKHLFVRNVNEICEKHHGVEKIVHKLYSKLLDENNIDREDLNIGYRRERLSRSRVFVVLDNVETLEQLALGYVFNLSKVFAAGSRIIITTRNKKVLQNAMAKIYNVECLNDEESTRLFSLHAFKQDRPQDNWMGKSRLATSYCKGNPLALKILGGALYGEDIHYWRSFLTGLRQPGNLGIENILRRSYDKLGKEEKKIFMDVACLLYGMSRSRLIDYMATMYSSSYVRVKDLIDKSLLTCVSSKNEDKIEVHDLLKEMAWNIVKEEPKLGKRSRLVDPDDVHKLLSTSEVKNWSTSIVNLFKGIVMVIPRRKRRKVTDMHEKGYDPLEEHRTTEGICLDLSGTKEMCLKANAFEGMNSLTFLKFESPEIKYPHYPLKNVKTKIHLPYYGLNSLPEGLRWLQWDGYPSKSLPAKFYPQHLVHLIIRGSPIRRCWEGYDQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSLVEVPFHVQYLTKLVTLDINYCKNLKRLPPKLDSKLLKHVRMKNLEVTCCPEIDSRELEEFDLSGTSLGELPSAIYNVKQNGVLRLHGKNITKFPGITTILKRFKLSLSGTSIREIDLADYHQQHQTSDGLLLPKFHNLSLTGNRQLEVLPNSIWNMISEELFICSSPLIESLPEISEPMSTLTSLHVFCCRSLTSIPTSISNLRSLISLCLVETGIKSLPSSIQELRQLFSIDLRDCKSLESIPNSIHKLSKLVTLSMSGCEIIISLPELPPNLKTLNVSGCKSLQALPSNTCKLLYLNTIHFDGCPQLDQAIPGEFVANFLVHASLSPSYERQVRCSGSELPKWFSYRSM

superfamily: SSF52540
165-406 SSF52540

TVQKQLIDMSPSINRNNLVAMGSRIFEVERLLAMDKLDDTCIIGLWEMGGVGKTTLAEACYDRVTSSNKGIKHLFVRNVNEICEKHHGVEKIVHKLYSKLLDENNIDREDLNIGYRRERLSRSRVFVVLDNVETLEQLALGYVFNLSKVFAAGSRIIITTRNKKVLQNAMAKIYNVECLNDEESTRLFSLHAFKQDRPQDNWMGKSRLATSYCKGNPLALKILGGALYGEDIHYWRSFLTGL

HMMPfam: PF00931
IPR002182
193-453 NB-ARC,NBS
NB-ARC

ERLLAMDKLDDTCIIGLWEMGGVGKTTLAEACYDRVTSSNKGIKHLFVRNVNEICEKHHGVEKIVHKLYSKLLDENNIDREDLNIGYRRERLSRSRVFVVLDNVETLEQLALGYVFNLSKVFAAGSRIIITTRNKKVLQNAMAKIYNVECLNDEESTRLFSLHAFKQDRPQDNWMGKSRLATSYCKGNPLALKILGGALYGEDIHYWRSFLTGLRQPGNLGIENILRRSYDKLGKEEKKIFMDVACLLYGMSRSRLIDYMA

FPrintScan: PR00364
IPR000767
206-221 DISEASERSIST
Disease resistance protein

IIGLWEMGGVGKTTLA

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

RLSRSRVFVVLDNVE

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

CKGNPLALKILGGAL

superfamily: SSF46785
412-520 SSF46785

LGIENILRRSYDKLGKEEKKIFMDVACLLYGMSRSRLIDYMATMYSSSYVRVKDLIDKSLLTCVSSKNEDKIEVHDLLKEMAWNIVKEEPKLGKRSRLVDPDDVHKLLS

superfamily: SSF52058
554-829 SSF52058,LRR

HEKGYDPLEEHRTTEGICLDLSGTKEMCLKANAFEGMNSLTFLKFESPEIKYPHYPLKNVKTKIHLPYYGLNSLPEGLRWLQWDGYPSKSLPAKFYPQHLVHLIIRGSPIRRCWEGYDQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSLVEVPFHVQYLTKLVTLDINYCKNLKRLPPKLDSKLLKHVRMKNLEVTCCPEIDSRELEEFDLSGTSLGELPSAIYNVKQNGVLRLHGKNITKFPGITTILKRFKLSLSGTSIREIDL

Gene3D: G3DSA:3.80.10.10
631-855 G3DSA:3.80.10.10

LRWLQWDGYPSKSLPAKFYPQHLVHLIIRGSPIRRCWEGYDQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSLVEVPFHVQYLTKLVTLDINYCKNLKRLPPKLDSKLLKHVRMKNLEVTCCPEIDSRELEEFDLSGTSLGELPSAIYNVKQNGVLRLHGKNITKFPGITTILKRFKLSLSGTSIREIDLADYHQQHQTSDGLLLPKFHNLSLTGN

FPrintScan: PR00364
IPR000767
720-736 DISEASERSIST
Disease resistance protein

QYLTKLVTLDINYCKNL

superfamily: SSF52058
803-1080 SSF52058,LRR

TKFPGITTILKRFKLSLSGTSIREIDLADYHQQHQTSDGLLLPKFHNLSLTGNRQLEVLPNSIWNMISEELFICSSPLIESLPEISEPMSTLTSLHVFCCRSLTSIPTSISNLRSLISLCLVETGIKSLPSSIQELRQLFSIDLRDCKSLESIPNSIHKLSKLVTLSMSGCEIIISLPELPPNLKTLNVSGCKSLQALPSNTCKLLYLNTIHFDGCPQLDQAIPGEFVANFLVHASLSPSYERQVRCSGSELPKWFSYRSMEDEDCSTVKVELPLAND

Gene3D: G3DSA:3.80.10.10
856-1029 G3DSA:3.80.10.10

RQLEVLPNSIWNMISEELFICSSPLIESLPEISEPMSTLTSLHVFCCRSLTSIPTSISNLRSLISLCLVETGIKSLPSSIQELRQLFSIDLRDCKSLESIPNSIHKLSKLVTLSMSGCEIIISLPELPPNLKTLNVSGCKSLQALPSNTCKLLYLNTIHFDGCPQLDQAIPGEF

HMMPfam: PF00560
IPR001611
985-1006 LRR_1
Leucine-rich repeat

NLKTLNVSGCKSLQALPSNTCK


Diseases

Disease Pathogen Avirulence gene
Flax rust

List of References

P N Dodds, G J Lawrence, J G Ellis
Six amino acid changes confined to the leucine-rich repeat beta-strand/beta-turn motif determine the difference between the P and P2 rust resistance specificities in flax.
Plant Cell: 2001, 13(1);163-78
PubMed:11158537 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox