PRGDB00035726 (RPG1)

From PRG Wiki
Jump to: navigation, search
RPG1
Gene Type Reference_R-Genes,_manually_curated
GenBank 117621925 (DQ854803)
Gene Class RLK
Domain Type Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare subsp. vulgare RPG1 (Rpg1) gene, Rpg1-Swiss Hv 489 allele, complete cds.

DNA Sequence

ATGGCGGCTGCCAGGAAGAAGATCGTGGTGAAGGTTGAGCTGAAAGACGACAGCCAGTGCAGGAAGGCGCTCAAAGCACTCTCTGCTCTCCGCGGCGTCTATGCGATTTCTTTTAACCGGGGGCATGGGAACATCACGGTCGTCGGCGAGGTTAACCCCGAGGATGTCCTGGCCAGGCTGCAAAAGAAGTTGTTTCCAAACGCTCAGATCGTCGCCGTCGGGCCCGCCAAGGAGAGGTCAAAGTACGAACTTACGTTCGAGTTCTTGAACCGTATCACAAACAATTTCTCCGAGGAGCGCATCATTGCTCGTGGTGGCCATGGAGTAGTTTACAAGGCAGTGCTGGACAATGGGCAGTACATTGCTGTCAAGAAGCTTCACCTCATGCCGGAGCTGGACGATGAGGAATTCAAAAACGAGTTTAATAATCTTATGAGGGTCCGACATCAAAATATCATACCGTTGGTTGGTTACTGCCATCATACAAAACAGGTGCTTGTTGAGCACAGTGGAAAGCATGTTTCTGCTCGAGTAGAAGAAAGATATTTATGCTCCGAATACTTGGAGGGAGGAAGCCTTGACAAGCATCTTTCTAATGAACCATGCGCACTTGCTTGGTACACATGTTACAAAATAATTAAAGGCATCTGTGATGGTTTACTTTGCCTTCACAAGGGATTCCAAGAGCCTATTTGGCATTTAGAATTAAAACCTACAAAAATTTTGCTGGATAAGGACATGATGCCCAAAATTGGAGGTTTTGGTTTCTCTAGACTCTTTGATTCAATAGAAACCTCCAGCACATCAGAAGTTAGGGGAACAAGTGTATATATGCCACCAGAATACATCAGTAAACGGCTAATCACATCAAGGTTTAATGTATTCAGTCTGGGTGTCATAATCTTGCAAATTATGGCAGGAAAGGAGAGCTATACCAAATGTGTAGACATTCCACCCGAAGAATTTACTGAGCGTGTATATGGATTCTGGGTAAATAGGATGCCGGGCACAGTATCGAAGCATACTTCCAATGAAGTTAAAACATGCATCGAAATAGCTCTAAAATGCGTGGAGTCCAATCGAGTGAACAGGCCTACTATAAATGAGATCATACAAAGGATGGATAAGATTGATATTGTTGAGTGCTCATCTTTAGGTGATCTATATAAGACAAGGGAGTTTGCATTCGAGTTCTTAGAACATATTACAAATGTTTTTTCTGAGCAGAACATAGTTGGTCGTGGTGCATGTGGTGTTATTTACAAGGGAGTGTTGGACAATGGAGAAGAAATTGCTGTTAAGAAACTTCATCAAACGTTGTCTATTGATGATGGGCTATTTAAGAAAGAGGTTAATAATGTAATGAGGGCCGAACATAAAAATATTGTACGGTTAGTTGGCTACTGCCACCATATATCACCAATAATTGTTGAGCACGAAGGAAAACATGTTTCTGCTAGTGTGATAGAAAGAGTGATTTGTTTCGAATACATGCAACGAGGAAGCCTTGACGACCAACTTTCAGCTGAATCCTGCAAACTTGATTGGGACAGATGTTACAAAATAATAAAAGGAATATGTGAGGGGTTACATTACCTTCATAATGCTGTCCCTCCCATTTACCATGGGGACTTAAAACCCGGAAATATTTTGCTGGATAAGGATATGGTGGCAAAGATCGGCGATTTTGGTTTGTCAAGAGTCTTTGATACAACGCAAACCTATATGACAACATCCGGAGTTATTAAAGGAACACCTGGATACATGTCACCAGAATACATCAATGAACATAAGATCAGTCTGAAGTCTGATGTATTTGCTCTCGGGGTCATAATCATAAAAATGATGACAGGAAAGGAGGACTACTCCAACTATGCACACACCCCTCGGGAAGAATTTATTGAGCATGTATGTAAAAAATGGCAAGTGAGGCTGCATGCAACAATGCGGTCCCATGTATTTGAAGAAGTGAGGACATGCATCGGAATAGCATTAAAATGTGTGGAGGATGACCGAACTCAAAGGCCTACGATGGCTCAGATTTTGAATGAATTAAGTAACATTGGTATTGTTAAGAGATCACCAGTAGATCGGGAAACAATGTCTACCCATGTATCCGAAGAAGTGAGGACATGCATCGAAATAGTGTTAAAATGTGTGGAGGATGACAGAACGCAAAGGCCTACAATAGCCCAGATTGTTAATGAACTAAGTAAGATTGGTATTGCTAAAGGTTCATCCATCAGCCAGATTTCCCAGGCTACTTCTTTCAGCCCAGAGCAGACGGCACAAGGAGGAGGCCATCAGGTAAACAAGCTGACTGCAACGCCACTAGAAGAAAAGTCGAGATCATGCCCTGGCCAAGCGTGCAAAGAACTGAAGCTAAAGAGGAAAGTAAAACTGAAGTTGAAGAGGAACGTAAAATGA


Protein sequences

Name Description Sequence
RPG1 RPG1 [Hordeum vulgare subsp. vulgare].

MAAARKKIVVKVELKDDSQCRKALKALSALRGVYAISFNRGHGNITVVGEVNPEDVLARLQKKLFPNAQIVAVGPAKERSKYELTFEFLNRITNNFSEERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRETMSTHVSEEVRTCIEIVLKCVEDDRTQRPTIAQIVNELSKIGIAKGSSISQISQATSFSPEQTAQGGGHQVNKLTATPLEEKSRSCPGQACKELKLKRKVKLKLKRNVK

Domains

Domain Start-End Description Sequence

HMMPfam: PF00403
IPR006121
21-63 HMA
Heavy metal-associated domain, HMA

RKALKALSALRGVYAISFNRGHGNITVVGEVNPEDVLARLQKK

superfamily: SSF56112
IPR011009
68-374 Kinase_like
Protein kinase-like domain

AQIVAVGPAKERSKYELTFEFLNRITNNFSEERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRM

HMMPanther: PTHR24420
82-444 PTHR24420,FAMILY NOT NAMED

YELTFEFLNRITNNFSEERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDD

HMMPanther: PTHR24420:SF754
82-444 PTHR24420:SF754

YELTFEFLNRITNNFSEERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDD

Gene3D: G3DSA:3.30.200.20
83-155 G3DSA:3.30.200.20

ELTFEFLNRITNNFSEERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPL

ProfileScan: PS50011
IPR000719
96-377 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKI

HMMPfam: PF00069
IPR000719
98-373 Pkinase,Ser-thr
Protein kinase, catalytic domain

EERIIARGGHGVVYKAVLDNGQYIAVKKLHLMPELDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

Gene3D: G3DSA:1.10.510.10
156-373 G3DSA:1.10.510.10

VGYCHHTKQVLVEHSGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

superfamily: SSF56112
IPR011009
378-708 Kinase_like
Protein kinase-like domain

DIVECSSLGDLYKTREFAFEFLEHITNVFSEQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRETMSTHVSEE

Gene3D: G3DSA:3.30.200.20
390-461 G3DSA:3.30.200.20

KTREFAFEFLEHITNVFSEQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKN

ProfileScan: PS50011
IPR000719
406-690 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGI

HMMPfam: PF00069
IPR000719
408-684 Pkinase,Ser-thr
Protein kinase, catalytic domain

EQNIVGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNE

Gene3D: G3DSA:1.10.510.10
462-685 G3DSA:1.10.510.10

IVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNEL

PatternScan: PS00108
IPR008271
540-552 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHGDLKPGNILL


Diseases

Disease Pathogen Avirulence gene
Stem Rust Puccinia graminis




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox