PRGDB00044645 (DRG01)

From PRG Wiki
Jump to: navigation, search
DRG01
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 66271017 (DQ018370)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species (Populus tomentosa x P. bolleana) x P. tomentosa var. truncata

Comment?

(Populus tomentosa x P. bolleana) x P. tomentosa var. truncata disease resistance protein (DRG01) mRNA, partial cds.

DNA Sequence

ATGCAGAAAGAAAAACGCAAGCAATCCAAAGATGAAGGCAACGATTCATCCTTGCGGAAGAGAAGAAAAGCTGACCTCAGTAAGCCTGTCAGTTTTGTCTCCACAGCTGCCAAGACAGAGCCAGAGTCTTCTCGATCTAGACCAGAAGGGGCCTATGATGTCTTCTTGAGTTTTAGAGGAGAAGACACTCGCAAGACATTTACAGATCATCTATATACTGCCTTGGTCCAAGCAGGAATCCGCACTTTTCGAGATGATGATGAACTTCCGAGAGGAGAAGAAATCTCCCATCATCTCCTTAGGGCAATTGAAGAATCAAGGATATCCATAGTTGTCTTCTCAAAAGGATATGCTTCTTCTAGATGGTGTCTCAATGAACTTGTAGAGATTCTTAAGTGCAAAAATAGGAAAACCGGTCAGATTGTTCTTCCTATATTCTTTGACATTGATCCTTCAGATGTGAGAAAACAGACTGCCAGTTTTGCGGAAGCATTTGTTAAACATGAAGAGCGTTCTCAAGAGAAGTTGGTGCAGGAGTGGAGAAAAGCTCTTAAGGAGGCTGGAAATCTATCTGGATGGAATCTGAATGATATGGCAAATGGGCATGAAGCAAAATTTATCAAAGAGATTATCAATGATGTGTTCAATAAATTAAGTCGCGAGTACTTATCTGTTCCTGAGCACCTAGTAGGTATGGATCTTGCTCATGATATTTTGGACTTTCTAAGTACTGCAACAGATGATGTATGCATTGCGGGCATACATGGGATGCCAGGAATAGGAAAGACGACAATAGCAAAAGTTGTATTTAATCAACTCTACTACAGATTCGAGGGAAGCTGCTTTCTTTCGAATATCAATGAAACATCAAAACAATTCAATGGTCTGGCTCTTTTACAAAAGCAACTTCTTCATGATATTTTAAAACAAGATGTTGCTAACATCAATTGTGTTGATAGAGGAAAGGTTCTGATCAAAGAGCGAATTCGTCGCAAAAGAGTTCTTGTTGTTGCTGATGATGTGGCTCATCCGGAACAGCTGAATGCATTGATGGGAGAGCGAAGTTGGTTTGGTCCCGGAAGTAGAGTAACTATTACAACAAGAGATTCAAATCTTCTTCGTGAAGCAGATCAAACATATCAGATCGAAGAATTGAAACCAGACGAGTCCCTTCAGCTTTTCAGCATCCATGCCTTTAAGGACTTCAAGCCAGCAGAAGATTATATTGAGCTTTCGAAGAAAGCCATTGGTTACTGTGGAGGACTTCCCCTCGCTCTAAAGGTC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [(Populus tomentosa x P. bolleana) x P. tomentosa var. truncata].

MQKEKRKQSKDEGNDSSLRKRRKADLSKPVSFVSTAAKTEPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVTITTRDSNLLREADQTYQIEELKPDESLQLFSIHAFKDFKPAEDYIELSKKAIGYCGGLPLALKV

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
40-193 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGW

ProfileScan: PS50104
IPR000157
50-190 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GAYDVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNL

Gene3D: G3DSA:3.40.50.10140
51-185 G3DSA:3.40.50.10140

AYDVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALK

HMMSmart: SM00255
IPR000157
51-190 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AYDVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNL

HMMPfam: PF01582
IPR000157
54-185 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALK

HMMPanther: PTHR11017
77-428 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVTITTRDSNLLREADQTYQIEELKPDESLQLFSIHAFKDFKPAEDYIELSKKAIGYCGGLPLALKV

HMMPanther: PTHR11017:SF20
77-428 PTHR11017:SF20,SUBFAMILY NOT NAMED

QAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVTITTRDSNLLREADQTYQIEELKPDESLQLFSIHAFKDFKPAEDYIELSKKAIGYCGGLPLALKV

superfamily: SSF52540
212-428 SSF52540

NDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVTITTRDSNLLREADQTYQIEELKPDESLQLFSIHAFKDFKPAEDYIELSKKAIGYCGGLPLALKV

HMMPfam: PF00931
IPR002182
236-428 NB-ARC,NBS
NB-ARC

HDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVTITTRDSNLLREADQTYQIEELKPDESLQLFSIHAFKDFKPAEDYIELSKKAIGYCGGLPLALKV

Gene3D: G3DSA:3.40.50.300
251-373 G3DSA:3.40.50.300

IAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVTITTRDSNLL

FPrintScan: PR00364
IPR000767
251-266 DISEASERSIST
Disease resistance protein

IAGIHGMPGIGKTTIA

FPrintScan: PR00364
IPR000767
328-342 DISEASERSIST
Disease resistance protein

RIRRKRVLVVADDVA

FPrintScan: PR00364
IPR000767
419-428 DISEASERSIST
Disease resistance protein

CGGLPLALKV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox