PRGDB00044646 (PIH2)

From PRG Wiki
Jump to: navigation, search
PIH2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 192807255 (AB442172)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Capsicum chinense

Comment?

Capsicum chinense PIH2 gene for disease resistance protein, complete cds.

DNA Sequence

ATGGAGATTGGCTTAGCAGTCGGTAGTGCAGTTGGTGGTGCATTTCTGAATGTTCTCTTTGATAGGCTTGCTCGTCGGGTTGAGCTGCTCAAGATGTTTCATGATGATGGGCTTTTAGAGAAGCTGGAGAACATTTTGCTTGGTCTTCAGATTGTGCTGAGTGATGCAGAGAATAAGCAGGCATCAGATCAACTCGTGAGGCAGTGGCTTAATAAGCTTCAAAGTGCTGTGGACTCTGCTGAAAACTTAATGGAACAAGTTAATTATGAGGCTTTGAAGCTTAAAGTGGAAGGTCAACATCAAAATCTTGCAGAAACATGTAACCAACAAGTATTTCGATTTTTTTCAGAGTGCTGTGGGCGGCGCTTGAGTGATGATTTTTTTCTTAACATAAAGGAGAAGTTGGAAAACACCATTAAAAGTTTGGAGGAGTTGGAAAAGCAAATTGGTCGCCTTGGATTACAGAGGTATTTCGATTCGGGTAAGAAACTAGAAACTAGAACACCTTCAACTTCTGTGGTTGAATCTGATGTCTTTGGTAGGAAGAATGAAATAGAGAAATTGATTGACCATTTAATGTCTAAGGAGGCAAGTGAGAAAAATATGACGGTTGTCCCTATTGTTGGAATGGGGGGCATGGGTAAGACAACACTTGCTAAAGCTGCTTACAATGCTGAGAAGGTGAAAAACCATTTTAATTTGAAAGCTTGGTTTTGTGTATCTGAGCCATATGATGCTTTCAGAATAACAAAAGGATTACTTCAAGATATGGGCTCATTTGACTTAAACGATGACAATAATCTTAATCGGTTACAAGTCAAATTGAAGGAAAAACTAAATGGAAAAAGGTTTCTCATTGTTCTAGATGATGTGTGGAATGACAACTACAACGAGTGGGATGACTTGAGGAATATTTTTGTTCACGGAGATATTGGAAGTAAGATCATCGTGACGACACGTAAAGAGAGTGTTGCCTTGATGATGAGTAGTGGGGCAATCAACGTGGGGACTCTGTCTGATGAAGCCTCTTGGGCTTTATTCAAACGACATTCATTAGAAAACAAGGATCCTATGGAACATCCGGAACTTGAAGAGGTTGGAAAAAAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCTTGTTACGCTCCGAATCAGAGGTTGAAGGGTGGAGACGTATTTTGAGAAGTGAAATATGGGACCTGTCGAACAATGACATATTACCAGCGTTAATGTTGAGCTACAATGAACTTCCCCCACATTTGAAGCCATGTTTTTCCTATTGTGCAATATTTCCTAGAGATTATCCATTTAGGAAAGAACAAATTATTCATTTGTGGATTGCTAATGGTCTTGTAGTACCACGGGAAGATGAAAGAATTCAAGATTTAGGCAACCAACTCTTTCTCGAGTTGAGATCAAGATCATTATTCGAAAGGGTTCCAAATCCTTCTGAAGGGAACACAGAGGAATTCTTAATGCATGATCTTGTCAATGATTTAGCCCAAATTGCATCTTCAAAACTCTGTGTCAGGTTGGAAGAATGCCAAGGATCTCATATGTTGGAAAAAAGTCAGCACATGTCGTATTCAATGGGGAGAGGTGGTGACTTTGAGAAATTGAAACCACTCATCAAATCAGAGCAGCTAAGGACACTGCTTCCAATAGAAATCCAGGACCTTTACGGCCCTAGGCTAAGCAAGAGGGTGCTGCATAACATACTGCCAAGTCTAAGATCCTTAAGGGCATTATCATTGTCTCATTACAGGATTAAGGAGTTGCCAGATGCTTTGTTTATCAAATTAAAGCTCCTCAGATTTTTGGACCTTTCTTGGACAGAGATTATAAAGTTGCCCTATTCTATCTGTACATTGTATAACTTGGAGACACTTCTCCTGTCATATTGTACATATCTTGAGGAGCTACCGCTGCAGATGGAAAATTTGATCAACCTGCGTCATCTTGACATAAGCAACACTTCTCATTTGAAGATGCCGCTACATCTGAGCAAGTTGAAAAGCCTCCAAGAGCTAGTCGGAGCCAATTTCCTTCTAGGTGGTCGCGGTGGTTGGAGAATGGAAGATTTGGGTGAAGCACATTACTTGTATGGATCTCTATCAATTTTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTCTGAAGGCAAACACGAGGGAGAAGAATCATGTTGAAAAGCTATCGTTAAAGTGGAGTGAAAATGATGCGGACAATTCTCAAACTGAAAGAGACATACTTGATGAGCTACTCCCACACACAGATATAAAAGAACTCAAAATCTCCGGATATAGAGGGACACAATTTCCAAATTGGCTAGCTGATCGTTCGTTTCTTAAGCTAGTGAAATTGTCTCTTAGCAACTGCAAGGACTGTTTTTCCTTGCCAGCACTGGGACAACTTCCTTGTTTGAAATTCCTTTCCATTAGAGAGATGCATCAAATAACAGAGGTGACGGAAGAATTCTATGGAAGTCCGTCCTCCAGAAAGCCTTTTAACTCTCTCGAGGAGCTTGAATTTGCAGCGATGCCGGAGTGGAAGCAGTGGCATGTACTAGGCAACGGAGAGTTTCCTGCACTTCAGGGCCTTTCCATTGAAGATTGCCCCAAGTTGATGGGGAAGTTGCCTGAAAATCTTTGTTCTCTGACAGAATTGATAATTTCAAGCTGCCCTGAACTCAATTTGGAGATGCCCATCCAACTTTCAAGTCTAAAAAAGTTTGAAGTTGATGGTTCTCCTAAGGCTGGAGTTCTCTTCGATGAAGCTGAACTGTTTACATCCCAAGTTAAGGGAACGAAGCAGATTGAGGAATTATGTATTAGTGACTGCAACTCTCTTACCTCCTTGCCTACTAGCACTCTGCCGAGTACCTTGAAGACAATAAGGATATGTCATTGCCGGAAATTGAAATTGGAGACTTCAGTTGGTGATATGAACTCTAACATGTTTCTGGAGGAATTGGCACTGGATGGATGTGATTCTATATCATCAGCTGAGTTGGTCCCTAGAGCACGCACTTTGTATGTAAAGAGTTGCCAAAACCTTACTAGGTTTTTGATTCCTAATGGGACTGAAAGACTCGATATTTGGGATTGTGAGAATCTTGAAATACTTTTGGTGGCATGTGGGACCCAGATGACGTCATTGAATATCCACAATTGTGCAAAGCTGAAGCGGCTGCCAGAACGTATGCAGGAACTTCTTCCATCTCTTAAGGAACTGAAACCCTACAGTTGTCCAGAAATAGAGTCCTTTCCTGATGGAGGATTGCCCTTCAATTTACAACTCCTTGGAATCAGCAATTGCGAGAAACTCCCCTCTCTCAGAGAGCTGTACATCTACCATAATGGCAGTGATGAAGAGATTGTTGGTGGTGAGAATTGGGAGTTGCCTAGCTCTATTCGAAGGCTTACCATAAGCAATCTGAAAACATTAAGCAGCCAACTTCTCAAAAGCCTCACCTCTCTTGAATCTCTAGATATTCGTAATTTACCTCAAATTCAGTCACTGCTGGAACAAGGGCTTCCCTCCTCTCTTTCTGAGCTTTATTTATATGACCATGATGAGCTCCATTCACTACCGACTGAAGGTCTTCGGCACCTCACTTCACTTCAAAGTCTATTGATCAGCAATTGCCCTCAACTCCAATCCCTTCCCAAATCAGCATTTCCCTCCTCCCTCTCTAAGCTGTCCATTAACAATTGCCCTAATCTCCAATCCCTTCCCAAATCAGCATTTCCGTGCTCCCTCTCTGAGCTGACCATCACACATTGCCCTAATCTCCAATCCCTTCCTGAAAAAGGGATGCCCTCTTCCCTCTCTACACTCTCTATTTACAACTGCCCATTGCTCAGACCACTCCTAGAATTTGACAAGGGGGAGTACTGGCCAGAAATTGCTCATATCTCCACCATAGAGATCGATTTCAGATACCTTTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Capsicum chinense].

MEIGLAVGSAVGGAFLNVLFDRLARRVELLKMFHDDGLLEKLENILLGLQIVLSDAENKQASDQLVRQWLNKLQSAVDSAENLMEQVNYEALKLKVEGQHQNLAETCNQQVFRFFSECCGRRLSDDFFLNIKEKLENTIKSLEELEKQIGRLGLQRYFDSGKKLETRTPSTSVVESDVFGRKNEIEKLIDHLMSKEASEKNMTVVPIVGMGGMGKTTLAKAAYNAEKVKNHFNLKAWFCVSEPYDAFRITKGLLQDMGSFDLNDDNNLNRLQVKLKEKLNGKRFLIVLDDVWNDNYNEWDDLRNIFVHGDIGSKIIVTTRKESVALMMSSGAINVGTLSDEASWALFKRHSLENKDPMEHPELEEVGKKIAAKCKGLPLALKTLAGLLRSESEVEGWRRILRSEIWDLSNNDILPALMLSYNELPPHLKPCFSYCAIFPRDYPFRKEQIIHLWIANGLVVPREDERIQDLGNQLFLELRSRSLFERVPNPSEGNTEEFLMHDLVNDLAQIASSKLCVRLEECQGSHMLEKSQHMSYSMGRGGDFEKLKPLIKSEQLRTLLPIEIQDLYGPRLSKRVLHNILPSLRSLRALSLSHYRIKELPDALFIKLKLLRFLDLSWTEIIKLPYSICTLYNLETLLLSYCTYLEELPLQMENLINLRHLDISNTSHLKMPLHLSKLKSLQELVGANFLLGGRGGWRMEDLGEAHYLYGSLSILELQNVVDRREALKANTREKNHVEKLSLKWSENDADNSQTERDILDELLPHTDIKELKISGYRGTQFPNWLADRSFLKLVKLSLSNCKDCFSLPALGQLPCLKFLSIREMHQITEVTEEFYGSPSSRKPFNSLEELEFAAMPEWKQWHVLGNGEFPALQGLSIEDCPKLMGKLPENLCSLTELIISSCPELNLEMPIQLSSLKKFEVDGSPKAGVLFDEAELFTSQVKGTKQIEELCISDCNSLTSLPTSTLPSTLKTIRICHCRKLKLETSVGDMNSNMFLEELALDGCDSISSAELVPRARTLYVKSCQNLTRFLIPNGTERLDIWDCENLEILLVACGTQMTSLNIHNCAKLKRLPERMQELLPSLKELKPYSCPEIESFPDGGLPFNLQLLGISNCEKLPSLRELYIYHNGSDEEIVGGENWELPSSIRRLTISNLKTLSSQLLKSLTSLESLDIRNLPQIQSLLEQGLPSSLSELYLYDHDELHSLPTEGLRHLTSLQSLLISNCPQLQSLPKSAFPSSLSKLSINNCPNLQSLPKSAFPCSLSELTITHCPNLQSLPEKGMPSSLSTLSIYNCPLLRPLLEFDKGEYWPEIAHISTIEIDFRYL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
7-1302 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

VGSAVGGAFLNVLFDRLARRVELLKMFHDDGLLEKLENILLGLQIVLSDAENKQASDQLVRQWLNKLQSAVDSAENLMEQVNYEALKLKVEGQHQNLAETCNQQVFRFFSECCGRRLSDDFFLNIKEKLENTIKSLEELEKQIGRLGLQRYFDSGKKLETRTPSTSVVESDVFGRKNEIEKLIDHLMSKEASEKNMTVVPIVGMGGMGKTTLAKAAYNAEKVKNHFNLKAWFCVSEPYDAFRITKGLLQDMGSFDLNDDNNLNRLQVKLKEKLNGKRFLIVLDDVWNDNYNEWDDLRNIFVHGDIGSKIIVTTRKESVALMMSSGAINVGTLSDEASWALFKRHSLENKDPMEHPELEEVGKKIAAKCKGLPLALKTLAGLLRSESEVEGWRRILRSEIWDLSNNDILPALMLSYNELPPHLKPCFSYCAIFPRDYPFRKEQIIHLWIANGLVVPREDERIQDLGNQLFLELRSRSLFERVPNPSEGNTEEFLMHDLVNDLAQIASSKLCVRLEECQGSHMLEKSQHMSYSMGRGGDFEKLKPLIKSEQLRTLLPIEIQDLYGPRLSKRVLHNILPSLRSLRALSLSHYRIKELPDALFIKLKLLRFLDLSWTEIIKLPYSICTLYNLETLLLSYCTYLEELPLQMENLINLRHLDISNTSHLKMPLHLSKLKSLQELVGANFLLGGRGGWRMEDLGEAHYLYGSLSILELQNVVDRREALKANTREKNHVEKLSLKWSENDADNSQTERDILDELLPHTDIKELKISGYRGTQFPNWLADRSFLKLVKLSLSNCKDCFSLPALGQLPCLKFLSIREMHQITEVTEEFYGSPSSRKPFNSLEELEFAAMPEWKQWHVLGNGEFPALQGLSIEDCPKLMGKLPENLCSLTELIISSCPELNLEMPIQLSSLKKFEVDGSPKAGVLFDEAELFTSQVKGTKQIEELCISDCNSLTSLPTSTLPSTLKTIRICHCRKLKLETSVGDMNSNMFLEELALDGCDSISSAELVPRARTLYVKSCQNLTRFLIPNGTERLDIWDCENLEILLVACGTQMTSLNIHNCAKLKRLPERMQELLPSLKELKPYSCPEIESFPDGGLPFNLQLLGISNCEKLPSLRELYIYHNGSDEEIVGGENWELPSSIRRLTISNLKTLSSQLLKSLTSLESLDIRNLPQIQSLLEQGLPSSLSELYLYDHDELHSLPTEGLRHLTSLQSLLISNCPQLQSLPKSAFPSSLSKLSINNCPNLQSLPKSAFPCSLSELTITHCPNLQSLPEKGMPSSLSTLSIYNCPLLRPLLEF

HMMPanther: PTHR23155
7-1302 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGSAVGGAFLNVLFDRLARRVELLKMFHDDGLLEKLENILLGLQIVLSDAENKQASDQLVRQWLNKLQSAVDSAENLMEQVNYEALKLKVEGQHQNLAETCNQQVFRFFSECCGRRLSDDFFLNIKEKLENTIKSLEELEKQIGRLGLQRYFDSGKKLETRTPSTSVVESDVFGRKNEIEKLIDHLMSKEASEKNMTVVPIVGMGGMGKTTLAKAAYNAEKVKNHFNLKAWFCVSEPYDAFRITKGLLQDMGSFDLNDDNNLNRLQVKLKEKLNGKRFLIVLDDVWNDNYNEWDDLRNIFVHGDIGSKIIVTTRKESVALMMSSGAINVGTLSDEASWALFKRHSLENKDPMEHPELEEVGKKIAAKCKGLPLALKTLAGLLRSESEVEGWRRILRSEIWDLSNNDILPALMLSYNELPPHLKPCFSYCAIFPRDYPFRKEQIIHLWIANGLVVPREDERIQDLGNQLFLELRSRSLFERVPNPSEGNTEEFLMHDLVNDLAQIASSKLCVRLEECQGSHMLEKSQHMSYSMGRGGDFEKLKPLIKSEQLRTLLPIEIQDLYGPRLSKRVLHNILPSLRSLRALSLSHYRIKELPDALFIKLKLLRFLDLSWTEIIKLPYSICTLYNLETLLLSYCTYLEELPLQMENLINLRHLDISNTSHLKMPLHLSKLKSLQELVGANFLLGGRGGWRMEDLGEAHYLYGSLSILELQNVVDRREALKANTREKNHVEKLSLKWSENDADNSQTERDILDELLPHTDIKELKISGYRGTQFPNWLADRSFLKLVKLSLSNCKDCFSLPALGQLPCLKFLSIREMHQITEVTEEFYGSPSSRKPFNSLEELEFAAMPEWKQWHVLGNGEFPALQGLSIEDCPKLMGKLPENLCSLTELIISSCPELNLEMPIQLSSLKKFEVDGSPKAGVLFDEAELFTSQVKGTKQIEELCISDCNSLTSLPTSTLPSTLKTIRICHCRKLKLETSVGDMNSNMFLEELALDGCDSISSAELVPRARTLYVKSCQNLTRFLIPNGTERLDIWDCENLEILLVACGTQMTSLNIHNCAKLKRLPERMQELLPSLKELKPYSCPEIESFPDGGLPFNLQLLGISNCEKLPSLRELYIYHNGSDEEIVGGENWELPSSIRRLTISNLKTLSSQLLKSLTSLESLDIRNLPQIQSLLEQGLPSSLSELYLYDHDELHSLPTEGLRHLTSLQSLLISNCPQLQSLPKSAFPSSLSKLSINNCPNLQSLPKSAFPCSLSELTITHCPNLQSLPEKGMPSSLSTLSIYNCPLLRPLLEF

superfamily: SSF52540
161-411 SSF52540

GKKLETRTPSTSVVESDVFGRKNEIEKLIDHLMSKEASEKNMTVVPIVGMGGMGKTTLAKAAYNAEKVKNHFNLKAWFCVSEPYDAFRITKGLLQDMGSFDLNDDNNLNRLQVKLKEKLNGKRFLIVLDDVWNDNYNEWDDLRNIFVHGDIGSKIIVTTRKESVALMMSSGAINVGTLSDEASWALFKRHSLENKDPMEHPELEEVGKKIAAKCKGLPLALKTLAGLLRSESEVEGWRRILRSEIWDLSNN

Gene3D: G3DSA:3.40.50.300
175-318 G3DSA:3.40.50.300

ESDVFGRKNEIEKLIDHLMSKEASEKNMTVVPIVGMGGMGKTTLAKAAYNAEKVKNHFNLKAWFCVSEPYDAFRITKGLLQDMGSFDLNDDNNLNRLQVKLKEKLNGKRFLIVLDDVWNDNYNEWDDLRNIFVHGDIGSKIIVT

HMMPfam: PF00931
IPR002182
181-462 NB-ARC,NBS
NB-ARC

RKNEIEKLIDHLMSKEASEKNMTVVPIVGMGGMGKTTLAKAAYNAEKVKNHFNLKAWFCVSEPYDAFRITKGLLQDMGSFDLNDDNNLNRLQVKLKEKLNGKRFLIVLDDVWNDNYNEWDDLRNIFVHGDIGSKIIVTTRKESVALMMSSGAINVGTLSDEASWALFKRHSLENKDPMEHPELEEVGKKIAAKCKGLPLALKTLAGLLRSESEVEGWRRILRSEIWDLSNNDILPALMLSYNELPPHLKPCFSYCAIFPRDYPFRKEQIIHLWIANGLVVPR

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

VVPIVGMGGMGKTTLA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

KLNGKRFLIVLDDVW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGLL

superfamily: SSF52058
499-979 SSF52058,LRR

LMHDLVNDLAQIASSKLCVRLEECQGSHMLEKSQHMSYSMGRGGDFEKLKPLIKSEQLRTLLPIEIQDLYGPRLSKRVLHNILPSLRSLRALSLSHYRIKELPDALFIKLKLLRFLDLSWTEIIKLPYSICTLYNLETLLLSYCTYLEELPLQMENLINLRHLDISNTSHLKMPLHLSKLKSLQELVGANFLLGGRGGWRMEDLGEAHYLYGSLSILELQNVVDRREALKANTREKNHVEKLSLKWSENDADNSQTERDILDELLPHTDIKELKISGYRGTQFPNWLADRSFLKLVKLSLSNCKDCFSLPALGQLPCLKFLSIREMHQITEVTEEFYGSPSSRKPFNSLEELEFAAMPEWKQWHVLGNGEFPALQGLSIEDCPKLMGKLPENLCSLTELIISSCPELNLEMPIQLSSLKKFEVDGSPKAGVLFDEAELFTSQVKGTKQIEELCISDCNSLTSLPTSTLPSTLKTIRICHCR

Gene3D: G3DSA:3.80.10.10
572-684 G3DSA:3.80.10.10

LSKRVLHNILPSLRSLRALSLSHYRIKELPDALFIKLKLLRFLDLSWTEIIKLPYSICTLYNLETLLLSYCTYLEELPLQMENLINLRHLDISNTSHLKMPLHLSKLKSLQEL

FPrintScan: PR00364
IPR000767
653-669 DISEASERSIST
Disease resistance protein

ENLINLRHLDISNTSHL

Gene3D: G3DSA:3.80.10.10
760-1024 G3DSA:3.80.10.10

DELLPHTDIKELKISGYRGTQFPNWLADRSFLKLVKLSLSNCKDCFSLPALGQLPCLKFLSIREMHQITEVTEEFYGSPSSRKPFNSLEELEFAAMPEWKQWHVLGNGEFPALQGLSIEDCPKLMGKLPENLCSLTELIISSCPELNLEMPIQLSSLKKFEVDGSPKAGVLFDEAELFTSQVKGTKQIEELCISDCNSLTSLPTSTLPSTLKTIRICHCRKLKLETSVGDMNSNMFLEELALDGCDSISSAELVPRARTLYVKSC

superfamily: SSF52058
1037-1313 SSF52058,LRR

ERLDIWDCENLEILLVACGTQMTSLNIHNCAKLKRLPERMQELLPSLKELKPYSCPEIESFPDGGLPFNLQLLGISNCEKLPSLRELYIYHNGSDEEIVGGENWELPSSIRRLTISNLKTLSSQLLKSLTSLESLDIRNLPQIQSLLEQGLPSSLSELYLYDHDELHSLPTEGLRHLTSLQSLLISNCPQLQSLPKSAFPSSLSKLSINNCPNLQSLPKSAFPCSLSELTITHCPNLQSLPEKGMPSSLSTLSIYNCPLLRPLLEFDKGEYWPEIAH

Gene3D: G3DSA:3.80.10.10
1038-1295 G3DSA:3.80.10.10

RLDIWDCENLEILLVACGTQMTSLNIHNCAKLKRLPERMQELLPSLKELKPYSCPEIESFPDGGLPFNLQLLGISNCEKLPSLRELYIYHNGSDEEIVGGENWELPSSIRRLTISNLKTLSSQLLKSLTSLESLDIRNLPQIQSLLEQGLPSSLSELYLYDHDELHSLPTEGLRHLTSLQSLLISNCPQLQSLPKSAFPSSLSKLSINNCPNLQSLPKSAFPCSLSELTITHCPNLQSLPEKGMPSSLSTLSIYNCPL

HMMPfam: PF00560
IPR001611
1215-1236 LRR_1
Leucine-rich repeat

SLQSLLISNCPQLQSLPKSAFP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox