PRGDB00044649 (Bor2)

From PRG Wiki
Jump to: navigation, search
Bor2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 16755866 (AF433641)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Brassica oleracea

Comment?

Brassica oleracea disease resistance protein (Bor2) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACTCATCTCACACAAATCAACAATAAACTTTTCAAGAAAAAGAATGTTTTTGACATTGTGGTTTGGATGGTGGTATCTAAGGATTTTCAGATCCAAAAGATTCAAGAAGAGATTGCGAAGAAGCTAAGCCTGACTGGCCAAGATTGGAACCAGAAAGATGAAGACCAAAAGTGCTGTGACATACATAATGTCCTAAAGAGGAAGAAGTTTGTTTTGCTGTTGGATGACATATTGGAAAAAGTTAATCTAGCGGAGATGGGAGTCCCGTATCCAACTGTAGAAAACGGTTGCAAAGTAATTTTCACCACTCGTTCTCTGGAATTGTGTGGGCGCATGGGAGCTGATGTTGAGATGGTAGTCCAGTGTTTGCCACCTCATGACGCATTGGAGTTGTTCAAAAAGAAAGTTGGAGAGATCACGCTAGGAAGTCATCCAAACATACCAGAGCTTGCTAGAATAGTTGCCAGAAAATGCCATGGCCTCCCCCTAGCCCTA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica oleracea].

GGVGKTTHLTQINNKLFKKKNVFDIVVWMVVSKDFQIQKIQEEIAKKLSLTGQDWNQKDEDQKCCDIHNVLKRKKFVLLLDDILEKVNLAEMGVPYPTVENGCKVIFTTRSLELCGRMGADVEMVVQCLPPHDALELFKKKVGEITLGSHPNIPELARIVARKCHGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-102 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTHLTQINNKLFKKKNVFDIVVWMVVSKDFQIQKIQEEIAKKLSLTGQDWNQKDEDQKCCDIHNVLKRKKFVLLLDDILEKVNLAEMGVPYPTVENG

HMMPanther: PTHR23155:SF119
1-102 PTHR23155:SF119,RFL1 (RPS5-LIKE 1)

GGVGKTTHLTQINNKLFKKKNVFDIVVWMVVSKDFQIQKIQEEIAKKLSLTGQDWNQKDEDQKCCDIHNVLKRKKFVLLLDDILEKVNLAEMGVPYPTVENG

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTHLTQINNKLFKKKNVFDIVVWMVVSKDFQIQKIQEEIAKKLSLTGQDWNQKDEDQKCCDIHNVLKRKKFVLLLDDILEKVNLAEMGVPYPTVENGCKVIFTTRSLELCGRMGADVEMVVQCLPPHDALELFKKKVGEITLGSHPNIPELARIVARKCHGLPLAL

superfamily: SSF52540
1-171 SSF52540

GGVGKTTHLTQINNKLFKKKNVFDIVVWMVVSKDFQIQKIQEEIAKKLSLTGQDWNQKDEDQKCCDIHNVLKRKKFVLLLDDILEKVNLAEMGVPYPTVENGCKVIFTTRSLELCGRMGADVEMVVQCLPPHDALELFKKKVGEITLGSHPNIPELARIVARKCHGLPLAL

Gene3D: G3DSA:3.40.50.300
2-115 G3DSA:3.40.50.300

GVGKTTHLTQINNKLFKKKNVFDIVVWMVVSKDFQIQKIQEEIAKKLSLTGQDWNQKDEDQKCCDIHNVLKRKKFVLLLDDILEKVNLAEMGVPYPTVENGCKVIFTTRSLELC

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

VLKRKKFVLLLDDIL

FPrintScan: PR00364
IPR000767
164-171 DISEASERSIST
Disease resistance protein

CHGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox