PRGDB00044650 (DRP)

From PRG Wiki
Jump to: navigation, search
DRP
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 194239625 (AB379683)
Gene Class Unknown
Domain Type
Gene Species Sesbania rostrata

Comment?

Sesbania rostrata DRP mRNA for disease resistance protein, partial cds.

DNA Sequence

CTGAGAAAGGTGGACAATACCATTGGATTATCAAGCATATTCCCCTTGTACTTATTCGTCAGACAGTGGGACGAAGATTTCATGACTATGAATTGCGCCCCATTCCCACGTTGGCCAATGGGAGAACTTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Sesbania rostrata].

EKGGQYHWIIKHIPLVLIRQTVGRRFHDYELRPIPTLANGRT







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox