PRGDB00044651 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186701227 (EF197847)
Gene Class T
Domain Type TIR, LRR
Gene Species Capsella rubella

Comment?

Capsella rubella miR319a microRNA locus, genomic sequence.

DNA Sequence

TATCTTTCTTGCAGCACTGATGACGTGTTCGTCAGTGATATCGTGACCAAGGTCAAGAAACTGTTTGTCTCTAAAGAGACACGGGAGACAAGAGCAGCAACAACAGTTGTAAATAACATTGATGCTGCCTTATTCTACTCCCAAACTTCGTTTTTACATGCTATAAACCGTGACATTACAGATTTTGAAGGCCTCACAGATACCCACAATGGTCTTGTAGTTCTGAGGCTTAAAGGACACTCTAATCTAGTGTTCCTCAAACTGAGTTCTCATGAAAATCTTGTCCGATATCTGAGTTCTTACTCGTTCAAATCCCTTACAGAGGTTTCTCTCCAATCCTAAATGAGTCTTGGAGAAAACCATCTCGGAAAGTTCCTAGTGACCTCTTTGAAAGGAGAATTGGAAAAGAACCAGATAGAAGTGGATTCAGAGGATGAGACGAAGAGCAGGACCGAAGAGTCAGGGGTTGCAGTAGTGTTCTTCTCAAATAAGTACCCTAAGTCAGAAAATTGTCTTGATGAGCTCGTTGAGATCAAGAAACTGATGGACGCAGGATCAATCGATGCCTTCCCTGTTTTTTACGGCTTGAAGGATGAACAAGTTGGGAAACTGAAAGGATGGTTCCATAACAGGCTTCTCAAGATAGAGAACGAAGTGCGTAATAACATCAAGACGAGAGATGATAAGTCTGTGCTTGATACCGAAGCTAAAATCTGGGGATGGAGAGACGCCATCTCGTCCATTGCCTCAAGACAGGGTCTGAGCATGATGAACTCTTCCGAGTCTCAGAAGCCTCAAGTGTTCATCAATTTCAGGGGTAAAGCTCTAAGAAAAAACCTGGTGAGCTTTCTAAAGCCAAAACTAGAAGAGAACAGGGGAATCAACGTTTACATAGACGAGGACGAGACTAGAGGGAGACCAATCACAACACTTTTCGAACGAATCAGAGAGTCAAGTATCGCACTAGTCATCTTCTCAGACAAGTACCCCGAGTCCCTCTGGTGCTTAGACGAGCTCGTTGAGATCAAGAAGCAGATGGACAAAGGAAATCTTGTCCCCTTTCCAATATTCTACAAAGTGAAAGCTTGGTCCGTCAAGAGCCAGACTGGTCCCTTCGGTAATACCCTCCTCAAGACTGAGCATGCCGCTCGCAAAAAGGTTGACCGGAGAAACACTAGGTCAATACTTGAAACAGAGGCTATGATTTGGGGATGGAGGCAAGCTTTAGTCTCCATAGGTGGAGTAATGGGGTTGACTTATGATCATAAGTGTGATGCTGATTTCGTTAATGATATTGTGGTCCAGGTCAAGAAAATGTTAGCTGATACTAAATCTCCAAAAAATGGTCTTACAATCATAAAGAAGCATCGGATACATCCTCATGAAGAAGTAACGTCGTTGGTACAAGCTCTAAACCTTGAGAGATCTGATCTTTATGATGTCAATGGCATCGTTTCCCAGGTCAGCATAGATCGTCTCGTGTTTCTTGACCTGATCTCTCTTAAGAATCCTGTAGTTATTCGGCGACTGCTCGAGCTAGTTCAATCTAGAAGGATTCTTTTGGTGTTGTTAGGTTCTCTAGAATACTACAATCATGTTAGTTTCCTAAACCCCTCAAAATCTTTTTCTCTGAAGTTTTTTTATAGCAATGTTAATTTGTATTATTGCTCTGTAGGTTTTCACTTTGAACCGTATCTTTCTACC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Capsella rubella].

MMNSSESQKPQVFINFRGKALRKNLVSFLKPKLEENRGINVYIDEDETRGRPITTLFERIRESSIALVIFSDKYPESLWCLDELVEIKKQMDKGNLVPFPIFYKVKAWSVKSQTGPFGNTLLKTEHAARKKVDRRNTRSILETEAMIWGWRQALVSIGGVMGLTYDHKCDADFVNDIVVQVKKMLADTKSPKNGLTIIKKHRIHPHEEVTSLVQALNLERSDLYDVNGIVSQVSIDRLVFLDLISLKNPVVIRRLLELVQSRRILLVLLGSLEYYNHVSFLNPSKSFSLKFFYSNVNLYYCSVGFHFEPYLSTMSLGENHLGKFLVTSLKGELEKNQIEVDSEDETKSRTEESGVAVVFFSNKYPKSENCLDELVEIKKLMDAGSIDAFPVFYGLKDEQVGKLKGWFHNRLLKIENEVRNNIKTRDDKSVLDTEAKIWGWRDAISSIASRQGLSYLSCSTDDVFVSDIVTKVKKLFVSKETRETRAATTVVNNIDAALFYSQTSFLHAINRDITDFEGLTDTHNGLVVLRLKGHSNLVFLKLSSHENLVRYLSSYSFKSLTEVSLQS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSESQKPQVFINFRGKALRKNLVSFLKPKLEENRGINVYIDEDETRGRPITTLFERIRESSIALVIFSDKYPESLWCLDELVEIKKQMDKGNLVPFPIFYKVKAWSVKSQTGPFGNTLLKTEHAARKKVDRRNTRSILETEAMIWGWRQALVSIGGVMGL

ProfileScan: PS50104
IPR000157
8-160 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QKPQVFINFRGKALRKNLVSFLKPKLEENRGINVYIDEDETRGRPITTLFERIRESSIALVIFSDKYPESLWCLDELVEIKKQMDKGNLVPFPIFYKVKAWSVKSQTGPFGNTLLKTEHAARKKVDRRNTRSILETEAMIWGWRQALVSIGGV

HMMSmart: SM00255
IPR000157
9-160 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KPQVFINFRGKALRKNLVSFLKPKLEENRGINVYIDEDETRGRPITTLFERIRESSIALVIFSDKYPESLWCLDELVEIKKQMDKGNLVPFPIFYKVKAWSVKSQTGPFGNTLLKTEHAARKKVDRRNTRSILETEAMIWGWRQALVSIGGV

Gene3D: G3DSA:3.40.50.10140
11-126 G3DSA:3.40.50.10140

QVFINFRGKALRKNLVSFLKPKLEENRGINVYIDEDETRGRPITTLFERIRESSIALVIFSDKYPESLWCLDELVEIKKQMDKGNLVPFPIFYKVKAWSVKSQTGPFGNTLLKTEH

HMMPfam: PF01582
IPR000157
12-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGKALRKNLVSFLKPKLEENRGINVYIDEDETRGRPITTLFERIRESSIALVIFSDKYPESLWCLDELVEIKKQMDKGNLVPFPIFYKVKAWSVKSQTGPFGNTLLKTEHAARKKVDRRNTRSILETEAMIWGWRQALV

HMMSmart: SM00255
IPR000157
319-450 TIR
Toll/interleukin-1 receptor homology (TIR) domain

NHLGKFLVTSLKGELEKNQIEVDSEDETKSRTEESGVAVVFFSNKYPKSENCLDELVEIKKLMDAGSIDAFPVFYGLKDEQVGKLKGWFHNRLLKIENEVRNNIKTRDDKSVLDTEAKIWGWRDAISSIASR

HMMPfam: PF01582
IPR000157
320-444 TIR
Toll/interleukin-1 receptor homology (TIR) domain

HLGKFLVTSLKGELEKNQIEVDSEDETKSRTEESGVAVVFFSNKYPKSENCLDELVEIKKLMDAGSIDAFPVFYGLKDEQVGKLKGWFHNRLLKIENEVRNNIKTRDDKSVLDTEAKIWGWRDAI

superfamily: SSF52200
IPR000157
323-453 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFLVTSLKGELEKNQIEVDSEDETKSRTEESGVAVVFFSNKYPKSENCLDELVEIKKLMDAGSIDAFPVFYGLKDEQVGKLKGWFHNRLLKIENEVRNNIKTRDDKSVLDTEAKIWGWRDAISSIASRQGL

ProfileScan: PS50104
IPR000157
351-450 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EESGVAVVFFSNKYPKSENCLDELVEIKKLMDAGSIDAFPVFYGLKDEQVGKLKGWFHNRLLKIENEVRNNIKTRDDKSVLDTEAKIWGWRDAISSIASR


List of References

Norman Warthmann, Sandip Das, Christa Lanz, Detlef Weigel
Comparative analysis of the MIR319a microRNA locus in Arabidopsis and related Brassicaceae.
Mol. Biol. Evol.: 2008, 25(5);892-902
PubMed:18296705 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox