PRGDB00044652 (RF12)

From PRG Wiki
Jump to: navigation, search
RF12
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18265367 (AB078516)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 1, P1 clone:R18I, complete sequence.

DNA Sequence

ATGGCTGGGGAACTTATTTCGTTTGGTATACAAAACCTGTGGAACCTACTGAGTCAAGAATGCGAGCTATTTCAGGGAGTCGAAGATCAAGTAACTGAACTAAAAAGGGATCTAAACATGTTAAGCTCTTTTCTGAAAGATGCAAATGCAAAGAAACATACAAGTGCGGTGGTGAAAAACTGTGTTGAAGAGATCAAGGAAATTATCTATGATGGAGAGGATACAATCGAAACATTTGTTCTTGAGCAAAACCTGGGAAAAACAAGTGGTATCAAGAAGAGTATCAGAAGACTTGCTTGCATTATTCCAGATCGGAGGAGATATGCATTAGGTATCGGAGGCTTAAGTAATAGGATCTCCAAGGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGGTATAAGCAACCTCAAGGTGATAAACAAAGGGAGATGCGACAAAAATTTTCTAAGGACGACGACAGCGATTTTGTGGGGTTGGAGGCAAATGTTAAGAAATTGGTTGGATATTTGGTGGACGAAGCAAACGTTCAAGTGGTTTCCATAACCGGTATGGGTGGTCTAGGTAAAACCACACTTGCTAAACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATGGGCTCTCATGGGTGTGTGTTTCACAAGATTTTACCCGAATGAATGTATGGCAAAAGATCTTGAGGGACCTCAAACCCAAAGAGGAAGAAAAGAAAATCATGGAGATGACACAAGATACACTCCAAGGTGAACTAATTCGATTGTTGGAAACGTCTAAGTCATTAATTGTCCTCGATGACATATGGGAAAAAGAAGATTGGGAACTAATCAAGCCAATATTTCCACCGACCAAAGGTTGGAAAGTGTTGCTTACTTCTCGAAATGAGAGTGTCGCCATGCGTAGAAATACATCATATATCAACTTTAAACCAGAATGCCTAACCACTGAAGACAGTTGGACACTTTTTCAGAGGATAGCACTTCCTATGAAAGATGCAGCTGAATTTAAGATTGATGAGGAAAAGGAAGAGTTGGGTAAGCTAATGATCAAACACTGTGGAGGGTTACCATTGGCCATCAGAGTGTTAGGAGGTATGTTAGCTGAAAAATACACATCGCATGATTGGAGAAGATTATCTGAGAATATTGGATCTCATCTCGTGGGAGGAAGAACTAACTTTAATGACGACAACAACAATACATGTAACAATGTATTGTCTCTAAGCTTTGAAGAATTGCCAAGTTATTTGAAGCATTGTTTCCTCTACTTGGCCCATTTTCCAGAAGATTATGAGATAAAGGTAGAGAACTTGTCATATTACTGGGCTGCAGAAGGAATATTCCAACCTAGGCATTACGATGGAGAGACCATTCGAGATGTTGGAGATGTCTACATAGAGGAGCTGGTGAGGAGGAATATGGTCATTTCCGAAAGAGATGTAAAGACTTCGAGATTTGAAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCTAAAGAAGAAAACTTCCTACAAATTACCAGTAGCCGCCCTTCAACTGCAAACTTGCAGTCTACTGTCACATCTCGCAGGTTTGTCTACCAATATCCTACTACTTTACATGTTGAGAAAGATATAAACAATCCAAAACTTCGAGCTCTCGTGGTTGTTACCTTGGGAAGTTGGAACCTGGCAGGTTCAAGCTTTACAAGGTTAGAACTTCTGAGGGTGTTAGATCTTATTGAAGTGAAGATTAAAGGAGGGAAGTTAGCTTCTTGCATTGGAAAGCTCATCCACTTAAGATACTTGAGCTTAGAGTATGCAGAGGTAACTCATATACCTTACTCACTAGGAAATCTGAAGTTGTT


Protein sequences

Name Description Sequence
disease resistance gene disease resistance gene [Arabidopsis thaliana].

MAGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNMLSSFLKDANAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRHYDGETIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF241
2-627 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE / PRM1 HOMOLOG, PUTATIV,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNMLSSFLKDANAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRHYDGETIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKL

HMMPanther: PTHR23155
2-627 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNMLSSFLKDANAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRHYDGETIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKL

superfamily: SSF52540
146-396 P-loop containing nucleoside triphosphate hydrolases

DKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVG

Gene3D: G3DSA:3.40.50.300
167-303 no description

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNE

HMMPfam: PF00931
IPR002182
167-459 NB-ARC,NBS
NB-ARC

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRH

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

Seg: seg
239-250 seg

KPKEEEKKIMEM

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLETSKSLIVLDDIW

Coil: coil
338-359 coiled-coil

KDAAEFKIDEEKEELGKLMIKH

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAIRVLGGML

Seg: seg
399-411 seg

TNFNDDNNNTCNN

superfamily: SSF52058
497-626 L domain-like,LRR

HLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLK

Gene3D: G3DSA:3.80.10.10
555-626 no description

KLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLK

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

TRLELLRVLDLIEVKIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox