PRGDB00044653 (RF12)

From PRG Wiki
Jump to: navigation, search
RF12
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18265367 (AB078516)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 1, P1 clone:R18I, complete sequence.

DNA Sequence

ATGGCTGGGGAACTTATTTCGTTTGGTATACAAAACCTGTGGAACCTACTGAGTCAAGAATGCGAGCTATTTCAGGGAGTCGAAGATCAAGTAACTGAACTAAAAAGGGATCTAAACTTGTTAAGCTCTTTTCTGAAAGATGCAGATGCAAAGAAACATACAAGTGCGGTGGTGAAAAACTGTGTTGAAGAGATCAAGGAAATTATCTATGATGGAGAGGATACAATCGAAACATTTGTTCTTGAGCAAAACCTGGGAAAAACAAGTGGTATCAAGAAGAGTATCAGAAGACTTGCTTGCATTATTCCAGATCGAAGGAGATATGCATTAGGTATCGGAGGCTTAAGTAATAGGATCTCCAAGGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGGTATAAGCAACCTCAAGGTGATAAACAAAGGGAGATGCGACCAAGATTTTCTAAGGACGACGATAGCGATTTTGTGGGGTTGGAAGCAAATGTTAAGAAATTGGTTGGATATTTGGTGGACGAAGCAAACGTTCAAGTGGTTTCCATAACCGGGATGGGTGGTCTAGGTAAAACCACACTTGCTAAACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATGGGCTCTCATGGGTGTGTGTTTCACAAGATTTTACCCGAATGAATGTATGGCAAAAGATCTTGAGGGACCTCAAACCCAAAGAGGAAGAAAAGAAAATCATGGAGATGACACAAGATACACTCCAAGGTGAACTAATTCGATTGTTGGAAACGTCTAAGTCATTAATTGTCCTCGATGACATATGGGAAAAAGAAGATTGGGAACTAATCAAGCCAATATTTCCACCGACCAAAGGTTGGAAAGTGTTGCTTACTTCTCGAAACGAGAGTGTCGCCATGCGTAGAAATACATCATATATCAACTTTAAACCAGAATGCCTAACCACTGAAGACAGTTGGACACTTTTTCAGAGGATAGCCCTTCCTATGAAAGATGCAGCTGAATTTAAGATTGATGAGGAAAAGGAAGAGTTGGGTAAGCTAATGATCAAACACTGTGGAGGGTTACCATTGGCCATCAGAGTGTTAGGAGGTATGTTAGCTGAAAAATACACATCGCATGATTGGAGAAGATTATCTGAGAATATTGGATCTCATCTCGTGGGAGGAAGAACTAACTTTAATGACGACAACAACAATACATGTAACTATGTATTGTCTCTAAGCTTTGAAGAATTGCCAAGTTATTTGAAGCATTGTTTCCTCTACTTGGCCCATTTTCCAGATGATTATGAGATAAACGTAAAGAATTTGTCATATTACTGGGCTGCAGAAGGAATATTCCAACCTAGGCATTACGATGGAGAAATCATTCGAGATGTTGGAGATGTCTACATAGAGGAGCTGGTGAGGAGGAATATGGTCATTTCCGAAAGAGATGTAAAGACTTCGAGATTTGAAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCCAAAGAAGAGAACTTCCTACAGATTACCAGTAGCCGCACTTCAACTGGAAACTCTCTGTCTATTGTCACATCTCGCAGGCTTGTCTACCAATATCCTATTACATTAGATGTTGAGAAAGATATAAACGATCCAAAACTTCGATCTCTCGTGGTTGTTGCCAATACTTATATGTTTTGGGGAGGTTGGAGTTGGATGCTGTTAGGTTCAAGCTTTATAAGGTTAGAACTACTGAGGGTATTAGATATCCATAGAGCCAAGTTGAAAGGAGGGAAGTTAGCTTCTTCCATTGGACAGCTCATCCACTTAAGATACTTGAACTTAAAGCATGCTGAGGTAACTCATATACCTTATTCACTAGGAAATCTGAAGTTGTTGATCTATCTGAATTTAGTCATTTTAGTCTCCGGATCTACATTGGTGCCCAATGTCTTGAAGGAGATGCAACAACTGAGATACCTTGCGTTACCAAAAGATATGGGGAGGAAGACAAAACTAGAATTGAGTAATCTAGTAAAATTGGAGACTTTGAAAAATTTCTCAACAAAGAATTGCAGCTTGGAGGATCTTCGTGGTATGGTCAGGCTGAGAACGCTCACCATCGAATTACGTAAGGAGACGAGTCTAGAAACTCTAGCTGCATCTATAGGCGGATTGAAATACCTCGAAAGCCTTACAATAACTGATCTTGGTTCTGAGATGAGGACGAAGGAAGCGGGAATCGTATTTGATTTCGTTTATCTCAAAACGCTAACGTTGAAACTGTATATGCCTAGGCTTTCTAAAGAACAACACTTCCCTTCTCACCTTACAACCTTATATCTACAACATTGTCGGTTGGAAGAGGATCCCATGCCGATTCTAGAGAAGTTGCATCAGTTGAAAGAGCTTGAATTAAGGCGTAAATCTTTCAGTGGAAAGGAAATGGTTTGCTCGAGCGGTGGGTTTCCTCAATTGCAGAAGCTTTCAATAAAAGGACTAGAGGAATGGGAAGATTGGAAAGTAGAAGAAAGCTCCATGCCAGTTCTTCATACTCTCGATATTCGGGATTGTCGAAAATTAAAGCAGCTTCCTGATGAACACCTTCCTTCTCACCTTACATCCATATCTCTATTTTTTTGTTGTTTGGAGGAGGATCCAATGCCGACTCTAGAGAGATTGGTTCACTTGAAAGAGCTTCAATTATTGTTTAGATCTTTCAGTGGGAGGATAATGGTTTGCGCTGGCAGTGGGTTTCCTCAACTGCACAAGCTAAAATTATCTGAACTAGATGGGTTGGAAGAGTGGATAGTAGAGGATGGCTCCATGCCACAGCTTCATACTCTGGAAATTCGTCGGTGTCCAAAGTTAAAGAAGCTTCCTAATGGGTTTCCACAATTGCAGAATCTTGAGTTAAATGAGCTAGAGGAATGGGAAGAGTGGATAGTAGAGGATGGCTCCATGCCACTTCTTCATACTCTAAGAATTTGGAATTGTCCAAAGTTAAAGCAGCTGCCTGATGGGTTGCGATTTATCTATTCATTAAAGAATTTGACTGTACCAAAGAGATGGAAGAAGAGATTGTCGAAAGGAGGAGAAGATTATTACAAAGTCCAACACATTCCTTCTGTTGAATTCTACTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MAGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNLLSSFLKDADAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKLKQLPDGLRFIYSLKNLTVPKRWKKRLSKGGEDYYKVQHIPSVEFY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
11-1004 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QNLWNLLSQECELFQGVEDQVTELKRDLNLLSSFLKDADAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKL

HMMPanther: PTHR11017:SF125
11-1004 PTHR11017:SF125,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

QNLWNLLSQECELFQGVEDQVTELKRDLNLLSSFLKDADAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKL

superfamily: SSF52540
146-396 SSF52540

DKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVG

Gene3D: G3DSA:3.40.50.300
167-303 G3DSA:3.40.50.300

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNE

HMMPfam: PF00931
IPR002182
167-459 NB-ARC,NBS
NB-ARC

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRH

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLETSKSLIVLDDIW

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAIRVLGGML

superfamily: SSF52058
497-835 SSF52058,LRR

HLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKG

Gene3D: G3DSA:3.80.10.10
579-733 G3DSA:3.80.10.10

SSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLES

superfamily: SSF52047
776-1021 SSF52047,LRR

PSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKLKQLPDGLRFIYSLKNLT

Gene3D: G3DSA:3.80.10.10
782-859 G3DSA:3.80.10.10

LYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRD

FPrintScan: PR00364
IPR000767
847-863 DISEASERSIST
Disease resistance protein

SSMPVLHTLDIRDCRKL

Gene3D: G3DSA:3.80.10.10
860-1021 G3DSA:3.80.10.10

CRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKLKQLPDGLRFIYSLKNLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox