PRGDB00044655 (RF12)

From PRG Wiki
Jump to: navigation, search
RF12
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18265367 (AB078516)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 1, P1 clone:R18I, complete sequence.

DNA Sequence

ATGGCAGGGGAACTTGTGTCGTTTGCAGTAAACAAGCTTTGGGACCTACTGAGCCATGAATACACGCTATTTCAGGGAGTCGAAGATCAAGTAGCTGAACTAAAAAGTGATCTAAACTTGCTAAAGTCGTTTTTGAAAGATGCAGATGCCAAGAAACACACAAGCGCATTGGTGAGATACTGTGTGGAGGAGATAAAGGATATTGTTTATGACGCAGAGGATGTACTCGAAACATTTGTACAAAAGGAAAAGCTTGGTACAACAAGTGGAATCAGGAAGCATATCAAAAGACTTACTTGCATTGTTCCAGATCGCAGGGAAATTGCATTATATATCGGACACGTAAGTAAGAGGATCACCAGGGTTATACGTGATATGCAGAGTTTTGGAGTACAACAAATGATTGTCGATGACTATATGCATCCTCTACGTAATAGAGAAAGGGAGATACGACGAACATTTCCTAAGGACAATGAAAGTGGTTTTGTGGCGTTGGAGGAAAATGTTAAAAAGTTAGTTGGATATTTTGTGGAGGAAGATAACTATCAAGTGGTTTCCATAACTGGAATGGGTGGTCTCGGTAAAACCACCCTTGCTAGACAAGTTTTTAACCACGATATGGTTACAAAGAAGTTTGATAAACTAGCATGGGTGAGTGTTTCACAAGATTTTACCCTGAAGAATGTATGGCAAAATATTTTGGGGGATCTCAAACCCAAAGAAGAAGAAACCAAAGAAGAAGAAAAGAAAATCTTGGAGATGACAGAATATACACTCCAACGTGAACTATATCAATTGTTGGAAATGTCTAAGTCGTTAATTGTCCTCGACGACATATGGAAGAAGGAAGATTGGGAAGTAATCAAGCCAATATTTCCACCGACAAAAGGTTGGAAACTGCTGCTTACTTCTCGAAATGAGAGTATCGTTGCGCCTACAAATACAAAATATTTCAACTTTAAACCAGAATGCCTAAAGACTGATGACAGTTGGAAACTTTTTCAAAGGATAGCATTTCCTATAAATGATGCATCTGAATTTGAGATTGATGAGGAAATGGAAAAGTTGGGTGAGAAAATGATCGAACATTGTGGAGGGCTACCATTGGCTATCAAAGTGTTAGGAGGTATGTTAGCTGAAAAATACACATCGCATGATTGGAGAAGATTATCTGAGAATATTGGATCTCATCTCGTGGGAGGAAGAACTAACTTTAATGACGACAACAACAATTCATGTAACTATGTATTGTCTTTGAGCTTTGAAGAATTGCCAAGTTATTTGAAGCATTGTTTCCTCTACTTGGCCCATTTTCCAGAAGATTATGAGATAAAGGTAGAGAATTTGTCATATTACTGGGCTGCAGAAGAAATATTCCAACCTAGGCATTACGATGGAGAAATCATTCGAGATGTTGGAGATGTCTACATAGAGGAGCTGGTGAGGAGGAATATGGTCATTTCCGAAAGAGATGTAAAGACTTCGAGATTTGAAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCTAAAGAAGAAAACTTCCTACAAATTACCAGTAACCCCCCTTCAACTGCAAATTTTCAGTCTACTGTCACATCTCGCAGGCTTGTCTACCAATATCCTACTACTTTACATGTTGAGAAAGATATAAACAATCCAAAACTTCGATCTCTCGTGGTTGTTACCTTGGGAAGTTGGAACATGGCAGGTTCAAGCTTTACAAGGTTAGAACTTCTAAGGGTGTTAGATCTCGTTCAAGCCAAGTTGAAAGGAGGGAAGTTAGCTTCTTGCATTGGAAAGCTCATCCACTTAAGATACTTGAGCTTAGAGTATGCAGAGGTAACTCATATACCTTACTCACTAGGAAATCTGAAGTTGTTGATCTATCTGAATTTACATATCTCATTATCATCAAGATCCAACTTTGTGCCCAATGTCTTGATGGGGATGCAAGAACTGAGATACCTTGCGTTACCAAGCCTTATCGAGAGGAAGACAAAACTAGAATTGAGTAATCTAGTAAAATTGGAGACTTTAGAGAATTTCTCAACAAAGAATAGCAGCTTGGAGGATCTTCGTGGTATGGTCAGGCTGAGAACGCTCACCATCGAATTAATTGAGGAGACGAGTTTAGAAACTCTAGCTGCATCTATAGGTGGATTGAAATACCTGGAAAAACTTGAAATAGATGATCTCGGTTCTAAGATGAGGACGAAGGAAGCGGGGATCGTATTTGATTTCGTTCATCTCAAAAGGCTAAGGTTGGAACTGTATATGCCTAGGCTTTCTAAAGAACAACACTTCCCTTCTCACCTTACAACCTTATATCTACAACATTGTCGGTTGGAAGAGGATCCCATGCCGATTCTAGAGAAGTTGCTACAGTTGAAAGAGCTTGAATTAGGGCATAAATCTTTCAGTGGAAAGAAAATGGTTTGCTCGAGCTGTGGGTTTCCTCAATTGCAGAAGCTTTCAATAAGCGGACTAAAGGAATGGGAAGATTGGAAAGTAGAAGAAAGCTCCATGCCACTTCTTCTTACTCTCAATATCTTTGATTGTCGAAAATTAAAGCAGCTTCCTGATGAACACCTCCCTTCTCACCTTACAGCCATATCTCTAAAAAAGTGTGGGTTGGAGGATCCAATCCCAACTCTAGAGAGATTGGTTCACTTGAAAGAGCTATCATTATCTGAACTATGTGGGAGGATAATGGTTTGCACGGGCGGTGGGTTTCCTCAATTGCACAAGCTAGACTTATCTGAACTAGATGGGTTGGAAGAGTGGATAGTTGAGGATGGCTCCATGCCACGGCTTCATACTCTAGAAATTCGTAGGTGTCTAAAGTTAAAGAAGCTACCTAATGGGTTTCCACAATTGCAGAATCTTCACTTAACTGAGGTAGAGGAATGGGAAGAGGGGATGATAGTAAAACAAGGCTCCATGCCCCTTCTTCATACTCTCTATATCTGGCATTGTCCAAAGCTTCCTGGTGAACAACACTTCCCTTCTCACCTTACAACCGTATTTCTACTCGGTATGTATGTGGAGGAGGATCCAATGCGGATTCTAGAGAAGCTGCTTCACTTGAAAAATGTTTCTTTGTTTCAATCTTTCAGTGGGAAGAGAATGGTTTGCTCGGGCGGTGGGTTTCCTCAATTGCAGAAGCTTTCAATACGGGAAATAGAGTGGGAAGAGTGGATAGTAGAACAAGGCTCCATGCCCCTTCTTCATACTCTCTATATCGGGGTTTGTCCAAACTTAAAGGAGCTTCCTGATGGGCTGCGATTTATCTATTCATTAAAAAATTTGATAGTATCAAAAAGATGGAAGAAGAGATTGTCGGAAGGAGGAGAAGATTATTACAAAGTCCAACACATTCCTTCTGTTGAATTCGACGACTAG


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Arabidopsis thaliana].

MAGELVSFAVNKLWDLLSHEYTLFQGVEDQVAELKSDLNLLKSFLKDADAKKHTSALVRYCVEEIKDIVYDAEDVLETFVQKEKLGTTSGIRKHIKRLTCIVPDRREIALYIGHVSKRITRVIRDMQSFGVQQMIVDDYMHPLRNREREIRRTFPKDNESGFVALEENVKKLVGYFVEEDNYQVVSITGMGGLGKTTLARQVFNHDMVTKKFDKLAWVSVSQDFTLKNVWQNILGDLKPKEEETKEEEKKILEMTEYTLQRELYQLLEMSKSLIVLDDIWKKEDWEVIKPIFPPTKGWKLLLTSRNESIVAPTNTKYFNFKPECLKTDDSWKLFQRIAFPINDASEFEIDEEMEKLGEKMIEHCGGLPLAIKVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNSCNYVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEEIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSNPPSTANFQSTVTSRRLVYQYPTTLHVEKDINNPKLRSLVVVTLGSWNMAGSSFTRLELLRVLDLVQAKLKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLHISLSSRSNFVPNVLMGMQELRYLALPSLIERKTKLELSNLVKLETLENFSTKNSSLEDLRGMVRLRTLTIELIEETSLETLAASIGGLKYLEKLEIDDLGSKMRTKEAGIVFDFVHLKRLRLELYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLLQLKELELGHKSFSGKKMVCSSCGFPQLQKLSISGLKEWEDWKVEESSMPLLLTLNIFDCRKLKQLPDEHLPSHLTAISLKKCGLEDPIPTLERLVHLKELSLSELCGRIMVCTGGGFPQLHKLDLSELDGLEEWIVEDGSMPRLHTLEIRRCLKLKKLPNGFPQLQNLHLTEVEEWEEGMIVKQGSMPLLHTLYIWHCPKLPGEQHFPSHLTTVFLLGMYVEEDPMRILEKLLHLKNVSLFQSFSGKRMVCSGGGFPQLQKLSIREIEWEEWIVEQGSMPLLHTLYIGVCPNLKELPDGLRFIYSLKNLIVSKRWKKRLSEGGEDYYKVQHIPSVEFDD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
10-1029 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VNKLWDLLSHEYTLFQGVEDQVAELKSDLNLLKSFLKDADAKKHTSALVRYCVEEIKDIVYDAEDVLETFVQKEKLGTTSGIRKHIKRLTCIVPDRREIALYIGHVSKRITRVIRDMQSFGVQQMIVDDYMHPLRNREREIRRTFPKDNESGFVALEENVKKLVGYFVEEDNYQVVSITGMGGLGKTTLARQVFNHDMVTKKFDKLAWVSVSQDFTLKNVWQNILGDLKPKEEETKEEEKKILEMTEYTLQRELYQLLEMSKSLIVLDDIWKKEDWEVIKPIFPPTKGWKLLLTSRNESIVAPTNTKYFNFKPECLKTDDSWKLFQRIAFPINDASEFEIDEEMEKLGEKMIEHCGGLPLAIKVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNSCNYVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEEIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSNPPSTANFQSTVTSRRLVYQYPTTLHVEKDINNPKLRSLVVVTLGSWNMAGSSFTRLELLRVLDLVQAKLKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLHISLSSRSNFVPNVLMGMQELRYLALPSLIERKTKLELSNLVKLETLENFSTKNSSLEDLRGMVRLRTLTIELIEETSLETLAASIGGLKYLEKLEIDDLGSKMRTKEAGIVFDFVHLKRLRLELYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLLQLKELELGHKSFSGKKMVCSSCGFPQLQKLSISGLKEWEDWKVEESSMPLLLTLNIFDCRKLKQLPDEHLPSHLTAISLKKCGLEDPIPTLERLVHLKELSLSELCGRIMVCTGGGFPQLHKLDLSELDGLEEWIVEDGSMPRLHTLEIRRCLKLKKLPNGFPQLQNLHLTEVEEWEEGMIVKQGSMPLLHTLYIWHCPKLPGEQHFPSHLTTVFLLGMYVEEDPMRILE

HMMPanther: PTHR11017:SF125
10-1029 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VNKLWDLLSHEYTLFQGVEDQVAELKSDLNLLKSFLKDADAKKHTSALVRYCVEEIKDIVYDAEDVLETFVQKEKLGTTSGIRKHIKRLTCIVPDRREIALYIGHVSKRITRVIRDMQSFGVQQMIVDDYMHPLRNREREIRRTFPKDNESGFVALEENVKKLVGYFVEEDNYQVVSITGMGGLGKTTLARQVFNHDMVTKKFDKLAWVSVSQDFTLKNVWQNILGDLKPKEEETKEEEKKILEMTEYTLQRELYQLLEMSKSLIVLDDIWKKEDWEVIKPIFPPTKGWKLLLTSRNESIVAPTNTKYFNFKPECLKTDDSWKLFQRIAFPINDASEFEIDEEMEKLGEKMIEHCGGLPLAIKVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNSCNYVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEEIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSNPPSTANFQSTVTSRRLVYQYPTTLHVEKDINNPKLRSLVVVTLGSWNMAGSSFTRLELLRVLDLVQAKLKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLHISLSSRSNFVPNVLMGMQELRYLALPSLIERKTKLELSNLVKLETLENFSTKNSSLEDLRGMVRLRTLTIELIEETSLETLAASIGGLKYLEKLEIDDLGSKMRTKEAGIVFDFVHLKRLRLELYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLLQLKELELGHKSFSGKKMVCSSCGFPQLQKLSISGLKEWEDWKVEESSMPLLLTLNIFDCRKLKQLPDEHLPSHLTAISLKKCGLEDPIPTLERLVHLKELSLSELCGRIMVCTGGGFPQLHKLDLSELDGLEEWIVEDGSMPRLHTLEIRRCLKLKKLPNGFPQLQNLHLTEVEEWEEGMIVKQGSMPLLHTLYIWHCPKLPGEQHFPSHLTTVFLLGMYVEEDPMRILE

superfamily: SSF52540
142-400 P-loop containing nucleoside triphosphate hydrolases

PLRNREREIRRTFPKDNESGFVALEENVKKLVGYFVEEDNYQVVSITGMGGLGKTTLARQVFNHDMVTKKFDKLAWVSVSQDFTLKNVWQNILGDLKPKEEETKEEEKKILEMTEYTLQRELYQLLEMSKSLIVLDDIWKKEDWEVIKPIFPPTKGWKLLLTSRNESIVAPTNTKYFNFKPECLKTDDSWKLFQRIAFPINDASEFEIDEEMEKLGEKMIEHCGGLPLAIKVLGGMLAEKYTSHDWRRLSENIGSHLVG

HMMPfam: PF00931
IPR002182
166-463 NB-ARC,NBS
NB-ARC

EENVKKLVGYFVEEDNYQVVSITGMGGLGKTTLARQVFNHDMVTKKFDKLAWVSVSQDFTLKNVWQNILGDLKPKEEETKEEEKKILEMTEYTLQRELYQLLEMSKSLIVLDDIWKKEDWEVIKPIFPPTKGWKLLLTSRNESIVAPTNTKYFNFKPECLKTDDSWKLFQRIAFPINDASEFEIDEEMEKLGEKMIEHCGGLPLAIKVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNSCNYVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEEIFQPRH

Gene3D: G3DSA:3.40.50.300
176-310 no description

FVEEDNYQVVSITGMGGLGKTTLARQVFNHDMVTKKFDKLAWVSVSQDFTLKNVWQNILGDLKPKEEETKEEEKKILEMTEYTLQRELYQLLEMSKSLIVLDDIWKKEDWEVIKPIFPPTKGWKLLLTSRNESIV

FPrintScan: PR00364
IPR000767
184-199 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

Seg: seg
238-256 seg

KPKEEETKEEEKKILEMTE

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LLEMSKSLIVLDDIW

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

CGGLPLAIKVLGGML

Seg: seg
404-414 seg

NFNDDNNNSCN

superfamily: SSF52058
501-928 L domain-like,LRR

HLHDMMREVCLLKAKEENFLQITSNPPSTANFQSTVTSRRLVYQYPTTLHVEKDINNPKLRSLVVVTLGSWNMAGSSFTRLELLRVLDLVQAKLKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLHISLSSRSNFVPNVLMGMQELRYLALPSLIERKTKLELSNLVKLETLENFSTKNSSLEDLRGMVRLRTLTIELIEETSLETLAASIGGLKYLEKLEIDDLGSKMRTKEAGIVFDFVHLKRLRLELYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLLQLKELELGHKSFSGKKMVCSSCGFPQLQKLSISGLKEWEDWKVEESSMPLLLTLNIFDCRKLKQLPDEHLPSHLTAISLKKCGLEDPIPTLERLVHLKELSLSELCGRIMVCTGGGFPQLHKLDLSELD

Seg: seg
624-643 seg

YSLGNLKLLIYLNLHISLSS

Seg: seg
705-719 seg

TLTIELIEETSLETL

Gene3D: G3DSA:3.80.10.10
779-862 no description

TLYLQHCRLEEDPMPILEKLLQLKELELGHKSFSGKKMVCSSCGFPQLQKLSISGLKEWEDWKVEESSMPLLLTLNIFDCRKLK

Seg: seg
795-806 seg

LEKLLQLKELEL

superfamily: SSF52058
860-1112 L domain-like,LRR

KLKQLPDEHLPSHLTAISLKKCGLEDPIPTLERLVHLKELSLSELCGRIMVCTGGGFPQLHKLDLSELDGLEEWIVEDGSMPRLHTLEIRRCLKLKKLPNGFPQLQNLHLTEVEEWEEGMIVKQGSMPLLHTLYIWHCPKLPGEQHFPSHLTTVFLLGMYVEEDPMRILEKLLHLKNVSLFQSFSGKRMVCSGGGFPQLQKLSIREIEWEEWIVEQGSMPLLHTLYIGVCPNLKELPDGLRFIYSLKNLIVSK

Gene3D: G3DSA:3.80.10.10
863-1111 no description

QLPDEHLPSHLTAISLKKCGLEDPIPTLERLVHLKELSLSELCGRIMVCTGGGFPQLHKLDLSELDGLEEWIVEDGSMPRLHTLEIRRCLKLKKLPNGFPQLQNLHLTEVEEWEEGMIVKQGSMPLLHTLYIWHCPKLPGEQHFPSHLTTVFLLGMYVEEDPMRILEKLLHLKNVSLFQSFSGKRMVCSGGGFPQLQKLSIREIEWEEWIVEQGSMPLLHTLYIGVCPNLKELPDGLRFIYSLKNLIVS

FPrintScan: PR00364
IPR000767
938-954 DISEASERSIST
Disease resistance protein

GSMPRLHTLEIRRCLKL

Seg: seg
1065-1074 seg

EIEWEEWIVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox