PRGDB00044657 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 66473096 (AC153125)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula clone mth2-74f16, complete sequence.

DNA Sequence

ATGGCAGTTGAATTTGTTGGTGGTGCTCTTCTTTCCGCTTTCCTTCAAGTCACATTCGAAAAGCTTGCTTCTGCTGAAATCGGAGACTACTTTCGAAGAACAAAACTCAATCACAATCTTCTAAAGAAACTCAACATCACACTTCTCTCCATCGATGCTGTGGTCGATGATGCAGAACTGAAGCAGATCAGAAATCCAAACGTGAGAGCATGGCTTGATGCTGTCAAAGATGCTGTGTTAGATGCAGAGGATCTCTTGGAAGAAATTGACTTTGAGGTTTCCAAATCTAAGCTGGAAGCTGAATCTCAATCTACTACTAACAAGGTATGGAACTTCTTCAATGCTTCTTCCAGTTCGTTTGACAAAGAAATTGAAACAAAGATGCAAGAAGTACTTGATAACCTAGAATATCTTTCTAGCAAAAAGGATATACTAGATTTGAAAAAGTCTACCAGTAGTTTTGATGTTGGATCTGGTAGCCAAGTGTCACAAAAATTGCCATCAACATCTTTGCCTGTTGATTCTATTATCTATGGCAGAGATGTTGATAAGGAGGTTATCTATGATTGGCTAAAATCTGACCCTGACAATGCAAACCATCAACTTTCAATAGTCTCTATAGTTGGTATGGGCGGGATGGGTAAGACCACGCTAGCCCAACATCTATACAATGACCCAAAGATGAAGGAAACATTTGATGTCAAAGCTTGGGTCTGTGTGTCAGAAGAATTTGATGTTTTCAAGGTAACAAGATCAATTCTTGAGGGTATCACTGGATCAACTGATGATAGCAGAGACCTAAATATGGTTCAAGAAAGGTTGAAGGAAAAATTGACAGGGAAGATATTTCTTCTTGTTTTAGATGACCTTTGGAACGAAAAACGTGACAAATGGATGACTTTGCAAACTCCTTTTAATTATGCGGCACATGGAAGCAAAATTCTTGTCACTACCCGTAGTGAGAAAGTTGCCTCAATCATGCGATCAAATAAAATGCTTCAACTTGATCAATTAGAAGAAGAACACTGCTGGAAGTTGTTTGCTAAACACGCGTGCCAAGATGAAGATCCTCAACTTAATCATGAGTTTAAGGACATTGCTAAAAGGATAATTACAAAATGCCAAGGATTGCCTCTAGCTTTGAAAACAATTGGAAGCCTCTTGTACACAAAATCATCTTTGGTGGAATGGAAAATAATATTGTCAAGCAAGATATGGGATTTACCAGAGGAGGAGAACAACATCATCCCTGCTTTAATGTTGAGCTATCATCACCTTCCTTCTCATCTCAAGAGATGTTTTGCTTATTGTGCCTTATTCCCCAAAAATTATGTGTTTAAAAAGGAGCATTTAATTTTATTATGGATGGCTGAAAATTTTCTACAATGCTCTCGACAGAGTATGAGTATGGAAGAAGTTGGGGAACAGTACTTCAATGATCTATTTTCGAGGTCATTTTTTCAGCAATCAAGGCGGTATAAAATGCAATTTATAATGCATGACCTTCTCAATGATTTGGCAAAATGTGTAAGTGGGGATTTTTCCTTTACATTTGAAGCTGAGGAATCGAATAATTTGTTGAACACGACTCGCCATTTTTCATTTACAAAAAATCCGTGTAAAGGTTCCAAAATATTTGAGACCTTACACAATGCTTATAAATCGCGCACATTCCTACCATTAGATATGACATCCTATGGTATTCCATCTCAATACCGGATATCTAGCACAGTGATGCAAGAGTTGTTCTCAAAGTTTAAGTTCTTTCGTGTCTTGTCGTTCTCTAGTTGCTCCTTTGAGAAGGAGTTGCCTGATACCATAGGCAATCTTAAACATCTCCGTTATCTAGACCTTTCTGGTAATTATAGCATAAAAAAGCTACCTGATTCAGTGTGTTATCTTTACAACTTGCAAACACTGAAGTTGAGGCATTGTTGGGGTTTGGAAGAGTTGCCCTTGAATTTGCATAAACTCACTAATTTGCGTTATCTTGATTTTAGTGGAACTAAAGTGAGAAAAATGCCAACGGCTATGGGGAAACTAAAACATCTTCAAGTGTTGAGTTCGTTTTATGTGGACAAAGGTAGCGAGGCCAATATTCAACAGTTAGGAGAACTCAATCTTCATGAAACACTATCAATTTTAGCGTTGCAAAACATTGACAATCCCTCTGATGCATCTGCAGCAAATTTAATAAATAAAGTACATCTTGTGAAGCTAGAGTTAGAATGGAATGCAAATAGTGATAATTCAGAGAAAGAAAGGGTAGTGCTTGAGAAGCTACAACCTTCCAAACACTTGAAGGAGTTATCTATCCGGAGCTATGGTGGTACACAATTTCCAAGCTGGTTTGGAGATAATTCATTATCAAATGTGGTGTCCTTAAAGTTGAGCAGTTGTAAAAACTGTGTGTTGTTGCCCCCACTTGGAATTTTGCCATCTCTCAAAGAACTGGAGATCGAAGAGCTATCTGGGCTAGTGGTTATTGGTAGTGAGTTTTATGGGAATGGGAGTGGTTCTTCTTCTGTTATTATTCCATTTGCTTCTTTGCAAACCTTACAATTCAAGGATATGGGGGAATGGGAAGAATGGGATTGTAAAATAGTGTCGGGTGCTTTTCCATGTCTCCAAGCACTTTCTATAGACAATTGTCCAAATTTAAAAGAGTGTTTGCCTGTGAACCTTCCCAGTTTAACGAAACTTCGAATTTATTTTTGTGCACGGCTTACTTCTTCTGTGTCATGGGGCACATCCATTCAGGACTTACATATAACTAATTGTGGAAAGCTGCAATTTGATAAACAGCTAACTAGTTTGAAATTTCTCAGTATTGGTGGACGATGCATGGAGGGATCGTTGCTTGAATGGATTGGGTACACCTTACCACATACCTCTATCCTGTCAATGGAAATTGTTGATTGCCCATCTATGAACATTATCCTAGACTGTTGCTACAGTTTCCTTCAAACTTTGATCATCATCGGTAGTTGTGACTCTCTAAGGACCTTTCCACTGAGTTTCTTCAAAAAACTTGATTATATGGTATTCCGAGGGTGTAGGAATCTTGAACTGATTACACAGGACTATAAGCTTGATTATAGCCTTGTGTATATGTCAATTACAGAATGCCCAAATTTTGTATCTTTTCCCGAGGGAGGATTCTCTGCACCCAGTCTGAAGAATTTTGATATTTGTAGATTGCAGAATTTAAAATCATTGCCAGAATGTATGCACACTCTCTTTCCATCTCTTACAAGCCTAACTATTGACGATTGTCCACAATTGGAGGTGTTCTCTAATGGAGGTTTGCCACCAAGCCTAAAATCCATGGTACTCTACGGATGCTCCAATCTTCTTCTGTCCTCACTGAAATGGGCTTTGGGAATCAACACTTCTCTAAAACGTCTGCATATTGGAAATGTGGATGTGGAGTCTTTTCCCGATCAAGGGTTGCTTCCACGCTCTCTTACTTCTCTCAGGATTGATGATTGTGTAAATCTTAAAAAACTGGACCACAAAGGTCTCTGCCACCTCTCCTCTCTTGAAGATTTGATTCTTAGTGGTTGCCCCAGCCTTCAATGCTTACCAGTGGAGGGACTGCCTAAAACCATTTCAGCTCTACAAGTTACGGATTGTTTGTTGCTTAAACAGCGATGCATGAAACCTAATGGTGAAGATTGGGGGAAGATTTCTCACATTCAATGTGTGGATCTCAAAGATGATTTTTCCTTTGAACCGCATTTTTTGAAGTACCTTTAG


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MAVEFVGGALLSAFLQVTFEKLASAEIGDYFRRTKLNHNLLKKLNITLLSIDAVVDDAELKQIRNPNVRAWLDAVKDAVLDAEDLLEEIDFEVSKSKLEAESQSTTNKVWNFFNASSSSFDKEIETKMQEVLDNLEYLSSKKDILDLKKSTSSFDVGSGSQVSQKLPSTSLPVDSIIYGRDVDKEVIYDWLKSDPDNANHQLSIVSIVGMGGMGKTTLAQHLYNDPKMKETFDVKAWVCVSEEFDVFKVTRSILEGITGSTDDSRDLNMVQERLKEKLTGKIFLLVLDDLWNEKRDKWMTLQTPFNYAAHGSKILVTTRSEKVASIMRSNKMLQLDQLEEEHCWKLFAKHACQDEDPQLNHEFKDIAKRIITKCQGLPLALKTIGSLLYTKSSLVEWKIILSSKIWDLPEEENNIIPALMLSYHHLPSHLKRCFAYCALFPKNYVFKKEHLILLWMAENFLQCSRQSMSMEEVGEQYFNDLFSRSFFQQSRRYKMQFIMHDLLNDLAKCVSGDFSFTFEAEESNNLLNTTRHFSFTKNPCKGSKIFETLHNAYKSRTFLPLDMTSYGIPSQYRISSTVMQELFSKFKFFRVLSFSSCSFEKELPDTIGNLKHLRYLDLSGNYSIKKLPDSVCYLYNLQTLKLRHCWGLEELPLNLHKLTNLRYLDFSGTKVRKMPTAMGKLKHLQVLSSFYVDKGSEANIQQLGELNLHETLSILALQNIDNPSDASAANLINKVHLVKLELEWNANSDNSEKERVVLEKLQPSKHLKELSIRSYGGTQFPSWFGDNSLSNVVSLKLSSCKNCVLLPPLGILPSLKELEIEELSGLVVIGSEFYGNGSGSSSVIIPFASLQTLQFKDMGEWEEWDCKIVSGAFPCLQALSIDNCPNLKECLPVNLPSLTKLRIYFCARLTSSVSWGTSIQDLHITNCGKLQFDKQLTSLKFLSIGGRCMEGSLLEWIGYTLPHTSILSMEIVDCPSMNIILDCCYSFLQTLIIIGSCDSLRTFPLSFFKKLDYMVFRGCRNLELITQDYKLDYSLVYMSITECPNFVSFPEGGFSAPSLKNFDICRLQNLKSLPECMHTLFPSLTSLTIDDCPQLEVFSNGGLPPSLKSMVLYGCSNLLLSSLKWALGINTSLKRLHIGNVDVESFPDQGLLPRSLTSLRIDDCVNLKKLDHKGLCHLSSLEDLILSGCPSLQCLPVEGLPKTISALQVTDCLLLKQRCMKPNGEDWGKISHIQCVDLKDDFSFEPHFLKYL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
9-909 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

ALLSAFLQVTFEKLASAEIGDYFRRTKLNHNLLKKLNITLLSIDAVVDDAELKQIRNPNVRAWLDAVKDAVLDAEDLLEEIDFEVSKSKLEAESQSTTNKVWNFFNASSSSFDKEIETKMQEVLDNLEYLSSKKDILDLKKSTSSFDVGSGSQVSQKLPSTSLPVDSIIYGRDVDKEVIYDWLKSDPDNANHQLSIVSIVGMGGMGKTTLAQHLYNDPKMKETFDVKAWVCVSEEFDVFKVTRSILEGITGSTDDSRDLNMVQERLKEKLTGKIFLLVLDDLWNEKRDKWMTLQTPFNYAAHGSKILVTTRSEKVASIMRSNKMLQLDQLEEEHCWKLFAKHACQDEDPQLNHEFKDIAKRIITKCQGLPLALKTIGSLLYTKSSLVEWKIILSSKIWDLPEEENNIIPALMLSYHHLPSHLKRCFAYCALFPKNYVFKKEHLILLWMAENFLQCSRQSMSMEEVGEQYFNDLFSRSFFQQSRRYKMQFIMHDLLNDLAKCVSGDFSFTFEAEESNNLLNTTRHFSFTKNPCKGSKIFETLHNAYKSRTFLPLDMTSYGIPSQYRISSTVMQELFSKFKFFRVLSFSSCSFEKELPDTIGNLKHLRYLDLSGNYSIKKLPDSVCYLYNLQTLKLRHCWGLEELPLNLHKLTNLRYLDFSGTKVRKMPTAMGKLKHLQVLSSFYVDKGSEANIQQLGELNLHETLSILALQNIDNPSDASAANLINKVHLVKLELEWNANSDNSEKERVVLEKLQPSKHLKELSIRSYGGTQFPSWFGDNSLSNVVSLKLSSCKNCVLLPPLGILPSLKELEIEELSGLVVIGSEFYGNGSGSSSVIIPFASLQTLQFKDMGEWEEWDCKIVSGAFPCLQALSIDNCPNLKECLPVNLPSLTKLRIYFCARL

HMMPanther: PTHR23155
9-909 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALLSAFLQVTFEKLASAEIGDYFRRTKLNHNLLKKLNITLLSIDAVVDDAELKQIRNPNVRAWLDAVKDAVLDAEDLLEEIDFEVSKSKLEAESQSTTNKVWNFFNASSSSFDKEIETKMQEVLDNLEYLSSKKDILDLKKSTSSFDVGSGSQVSQKLPSTSLPVDSIIYGRDVDKEVIYDWLKSDPDNANHQLSIVSIVGMGGMGKTTLAQHLYNDPKMKETFDVKAWVCVSEEFDVFKVTRSILEGITGSTDDSRDLNMVQERLKEKLTGKIFLLVLDDLWNEKRDKWMTLQTPFNYAAHGSKILVTTRSEKVASIMRSNKMLQLDQLEEEHCWKLFAKHACQDEDPQLNHEFKDIAKRIITKCQGLPLALKTIGSLLYTKSSLVEWKIILSSKIWDLPEEENNIIPALMLSYHHLPSHLKRCFAYCALFPKNYVFKKEHLILLWMAENFLQCSRQSMSMEEVGEQYFNDLFSRSFFQQSRRYKMQFIMHDLLNDLAKCVSGDFSFTFEAEESNNLLNTTRHFSFTKNPCKGSKIFETLHNAYKSRTFLPLDMTSYGIPSQYRISSTVMQELFSKFKFFRVLSFSSCSFEKELPDTIGNLKHLRYLDLSGNYSIKKLPDSVCYLYNLQTLKLRHCWGLEELPLNLHKLTNLRYLDFSGTKVRKMPTAMGKLKHLQVLSSFYVDKGSEANIQQLGELNLHETLSILALQNIDNPSDASAANLINKVHLVKLELEWNANSDNSEKERVVLEKLQPSKHLKELSIRSYGGTQFPSWFGDNSLSNVVSLKLSSCKNCVLLPPLGILPSLKELEIEELSGLVVIGSEFYGNGSGSSSVIIPFASLQTLQFKDMGEWEEWDCKIVSGAFPCLQALSIDNCPNLKECLPVNLPSLTKLRIYFCARL

superfamily: SSF52540
160-411 SSF52540

SQVSQKLPSTSLPVDSIIYGRDVDKEVIYDWLKSDPDNANHQLSIVSIVGMGGMGKTTLAQHLYNDPKMKETFDVKAWVCVSEEFDVFKVTRSILEGITGSTDDSRDLNMVQERLKEKLTGKIFLLVLDDLWNEKRDKWMTLQTPFNYAAHGSKILVTTRSEKVASIMRSNKMLQLDQLEEEHCWKLFAKHACQDEDPQLNHEFKDIAKRIITKCQGLPLALKTIGSLLYTKSSLVEWKIILSSKIWDLPEE

Gene3D: G3DSA:3.40.50.300
179-322 G3DSA:3.40.50.300

GRDVDKEVIYDWLKSDPDNANHQLSIVSIVGMGGMGKTTLAQHLYNDPKMKETFDVKAWVCVSEEFDVFKVTRSILEGITGSTDDSRDLNMVQERLKEKLTGKIFLLVLDDLWNEKRDKWMTLQTPFNYAAHGSKILVTTRSEK

HMMPfam: PF00931
IPR002182
187-464 NB-ARC,NBS
NB-ARC

IYDWLKSDPDNANHQLSIVSIVGMGGMGKTTLAQHLYNDPKMKETFDVKAWVCVSEEFDVFKVTRSILEGITGSTDDSRDLNMVQERLKEKLTGKIFLLVLDDLWNEKRDKWMTLQTPFNYAAHGSKILVTTRSEKVASIMRSNKMLQLDQLEEEHCWKLFAKHACQDEDPQLNHEFKDIAKRIITKCQGLPLALKTIGSLLYTKSSLVEWKIILSSKIWDLPEEENNIIPALMLSYHHLPSHLKRCFAYCALFPKNYVFKKEHLILLWMAENFLQCS

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

IVSIVGMGGMGKTTLA

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

KLTGKIFLLVLDDLW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CQGLPLALKTIGSLL

superfamily: SSF52058
498-944 SSF52058,LRR

IMHDLLNDLAKCVSGDFSFTFEAEESNNLLNTTRHFSFTKNPCKGSKIFETLHNAYKSRTFLPLDMTSYGIPSQYRISSTVMQELFSKFKFFRVLSFSSCSFEKELPDTIGNLKHLRYLDLSGNYSIKKLPDSVCYLYNLQTLKLRHCWGLEELPLNLHKLTNLRYLDFSGTKVRKMPTAMGKLKHLQVLSSFYVDKGSEANIQQLGELNLHETLSILALQNIDNPSDASAANLINKVHLVKLELEWNANSDNSEKERVVLEKLQPSKHLKELSIRSYGGTQFPSWFGDNSLSNVVSLKLSSCKNCVLLPPLGILPSLKELEIEELSGLVVIGSEFYGNGSGSSSVIIPFASLQTLQFKDMGEWEEWDCKIVSGAFPCLQALSIDNCPNLKECLPVNLPSLTKLRIYFCARLTSSVSWGTSIQDLHITNCGKLQFDKQLTSLKFLSI

Gene3D: G3DSA:3.80.10.10
571-773 G3DSA:3.80.10.10

QYRISSTVMQELFSKFKFFRVLSFSSCSFEKELPDTIGNLKHLRYLDLSGNYSIKKLPDSVCYLYNLQTLKLRHCWGLEELPLNLHKLTNLRYLDFSGTKVRKMPTAMGKLKHLQVLSSFYVDKGSEANIQQLGELNLHETLSILALQNIDNPSDASAANLINKVHLVKLELEWNANSDNSEKERVVLEKLQPSKHLKELSIR

FPrintScan: PR00364
IPR000767
608-624 DISEASERSIST
Disease resistance protein

GNLKHLRYLDLSGNYSI

HMMPfam: PF00560
IPR001611
612-631 LRR_1
Leucine-rich repeat

HLRYLDLSGNYSIKKLPDSV

ProfileScan: PS51450
IPR001611
612-634 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSGNYSIKKLPDSVCYL

ProfileScan: PS51450
IPR001611
636-659 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLKLRHCWGLEELPLNLHKLT

ProfileScan: PS51450
IPR001611
660-681 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRYLDFSGTKVRKMPTAMGKL

Gene3D: G3DSA:3.80.10.10
788-1002 G3DSA:3.80.10.10

SLSNVVSLKLSSCKNCVLLPPLGILPSLKELEIEELSGLVVIGSEFYGNGSGSSSVIIPFASLQTLQFKDMGEWEEWDCKIVSGAFPCLQALSIDNCPNLKECLPVNLPSLTKLRIYFCARLTSSVSWGTSIQDLHITNCGKLQFDKQLTSLKFLSIGGRCMEGSLLEWIGYTLPHTSILSMEIVDCPSMNIILDCCYSFLQTLIIIGSCDSLRT

superfamily: SSF52058
988-1232 SSF52058,LRR

LQTLIIIGSCDSLRTFPLSFFKKLDYMVFRGCRNLELITQDYKLDYSLVYMSITECPNFVSFPEGGFSAPSLKNFDICRLQNLKSLPECMHTLFPSLTSLTIDDCPQLEVFSNGGLPPSLKSMVLYGCSNLLLSSLKWALGINTSLKRLHIGNVDVESFPDQGLLPRSLTSLRIDDCVNLKKLDHKGLCHLSSLEDLILSGCPSLQCLPVEGLPKTISALQVTDCLLLKQRCMKPNGEDWGKISH

Gene3D: G3DSA:3.80.10.10
1033-1208 G3DSA:3.80.10.10

YSLVYMSITECPNFVSFPEGGFSAPSLKNFDICRLQNLKSLPECMHTLFPSLTSLTIDDCPQLEVFSNGGLPPSLKSMVLYGCSNLLLSSLKWALGINTSLKRLHIGNVDVESFPDQGLLPRSLTSLRIDDCVNLKKLDHKGLCHLSSLEDLILSGCPSLQCLPVEGLPKTISALQ

ProfileScan: PS51450
IPR001611
1132-1153 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKRLHIGNVDVESFPDQGLLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox